Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 52 (11 Dec 2019)
Sequence version 1 (28 Jun 2011)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Mediator of RNA polymerase II transcription subunit 13

Gene

MED13

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. The Mediator complex, having a compact conformation in its free form, is recruited to promoters by direct interactions with regulatory proteins and serves for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Acts closely together with MAB12. Involved in the regulation of embryo patterning and cotyledon organogenesis. May act through transient repression of specific genes such as the ones responsive to auxin.3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein, Repressor
Biological processGrowth regulation, Transcription, Transcription regulation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Mediator of RNA polymerase II transcription subunit 13
Alternative name(s):
Protein GRAND CENTRAL
Protein MACCHI-BOU 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MED13
Synonyms:GCT, MAB2, MED13_1
Ordered Locus Names:At1g55325
ORF Names:F7A10.14
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiArabidopsis thaliana (Mouse-ear cress)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri3702 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliopsidaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000006548 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Arabidopsis Information Portal

More...
Araporti
AT1G55325

The Arabidopsis Information Resource

More...
TAIRi
locus:1005716738 AT1G55325

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cell wall Cytoskeleton Vacuole Chloroplast Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertion Graphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Abnormal embryo and cotyledon development, and embryo lethality in most cases. When viable, plants are small with greatly delayed flowering time and sterile flowers.3 Publications

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi407S → N in gct-3; uncoupled cell division, pattern formation and morphogenesis during embryogenesis. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00004157341 – 1921Mediator of RNA polymerase II transcription subunit 13Add BLAST1921

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki220Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)Combined sources
Cross-linki226Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)Combined sources

Keywords - PTMi

Isopeptide bond, Ubl conjugation

Proteomic databases

PRoteomics IDEntifications database

More...
PRIDEi
F4I096

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
F4I096

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous. Highest expression in the shoot apex.1 Publication

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed in both the apical and basal cell at the one-cell embryo stage and in all cells of the embryo and suspensor through the globular stage. Decreases in the periphery of the hypocotyl and on the abaxial side of cotyledons from the heart stage to the torpedo stage, and by the bent cotyledon stage, restricted to the vascular tissue and the shoot and root apical meristems.1 Publication

Gene expression databases

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
F4I096 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
F4I096 AT

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the Mediator complex.

Interacts with CYCC1-2 (CDK8 homolog).

2 Publications

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
27203, 1 interactor

STRING: functional protein association networks

More...
STRINGi
3702.AT1G55325.2

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
F4I096

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi407 – 426Ser-richAdd BLAST20
Compositional biasi486 – 495Poly-Asp10

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the Mediator complex subunit 13 family.Curated

Phylogenomic databases

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
F4I096

KEGG Orthology (KO)

More...
KOi
K15164

Identification of Orthologs from Complete Genome Data

More...
OMAi
CRGRSNA

Database of Orthologous Groups

More...
OrthoDBi
19529at2759

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR021643 Mediator_Med13_N_met/fun
IPR041285 MID_MedPIWI

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF11597 Med13_N, 1 hit
PF18296 MID_MedPIWI, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: A number of isoforms are produced. According to EST sequences.

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: F4I096-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MWTNVFRIGG LHNVSWFQFL PSETELNPGF DRSSRAEQNE VATYLVLSSH
60 70 80 90 100
LRLQKEGFLT TWTNSFVGPW DPSQGLYNPD EKIKLWLFLP GRHSSISDKA
110 120 130 140 150
QAAVSKLRVV ASGIWVAPGD SEEISVAFSQ SLRNCIERAL SGISYMRFGD
160 170 180 190 200
VFSKFSPQSE EYLRRGQPTV EFIFAATEEA VFVHVIISAK NVRTLSSGDA
210 220 230 240 250
ERMLRSSLKN SSYRLPAFRK CLGLAKSEDN RLCYINTSHR PMLFPPVIVS
260 270 280 290 300
PHGMRGSLTG FCPNDLVKQV YFSSGNLKTS TGYVGLPSHI GRGSRLINGN
310 320 330 340 350
HCYVEVTLGC CQNRNDNTSQ ANSTFAVNLP HNQCPEPSVG SKDHRKGQSD
360 370 380 390 400
LSSVCEKKFI YPAEAVLVPI LQSAFAKFSL KRAGDFDCLG ASENKSDGFY
410 420 430 440 450
EKNGYNSSGS SRNSSISSTS SASSGSGWRM TSRTGDLDAD ADSLTCRQSG
460 470 480 490 500
LTCNDDRLKM GSKRPRTGMA ESFGQVGIEN DQIGWDWDAD DDDDDREVGM
510 520 530 540 550
DIKALLSEFG DFGDFFENDA LPFGEPPGTA ESHVLVFPPD SADVGSSPVD
560 570 580 590 600
MMDVSDQIVL PVGFSSFESF NPVPPIIDEC LIKSQEVLHS SITSVPSNQM
610 620 630 640 650
SISSTGEFDH LLKAEAMMTF APEYGAVEAP MSEISSTFFK SPYLPKSHKV
660 670 680 690 700
ESSNSRTSNY VYGATPPTTD SDGAGDMILF GSKSCIGNNA GRTLYHSREH
710 720 730 740 750
YTQVEGRKGR HDKLPTVISD NSSTKEGVSQ SIHSKHSAAN AVKVVQGKKT
760 770 780 790 800
DGISAVVSTL LSSKTLLATD VGSVMFQAFM CRMRHIITSS KHSSPVSLTR
810 820 830 840 850
LSGNFFLNQL SNEPSTLTDN ISARNEIYKK DIPTRIAGDF DGGMLDSHMS
860 870 880 890 900
APVGVWRTVS VPKTAKPASS PNIEAGSSLP HSSFSEDSLL SYGQRQPLQD
910 920 930 940 950
LLDGIALLVQ QATSFVDLAL DSDCGDGPYG WLALEELWRR ELSCGPSAGH
960 970 980 990 1000
AGCGGTLASC HSLDIAGVKL VDPLSAEVFP SSVITLLQSD IKTALKSAFG
1010 1020 1030 1040 1050
QSDGPLSVTD WCKGRNQSGD GGSISEGFTA ESALSEVNGV NISDDFIIDK
1060 1070 1080 1090 1100
YFGKQAVSNA IDGGKGDETA QSQDIYSSEL LRPTLFVLPS PAILVGYQDD
1110 1120 1130 1140 1150
WLKISTNSLT HWEKAPFEPY ALPKSINYAV VCPDIDPLTC AATDFFQQLG
1160 1170 1180 1190 1200
TGESTSLSFV KEVMLKHDRN WLGTHLPQSL GNQMEKDVGR LSSSGFVLLD
1210 1220 1230 1240 1250
CPQSMKIESN NTSLLGSLSD YFLSLSNGWN VNSYLKSLSK ALKGLKLGSG
1260 1270 1280 1290 1300
LYTNQKEGSG SPCVVVYIVC PFPDPSAVLR TIVESSIALG SVIQSDRDRR
1310 1320 1330 1340 1350
SILNSQVARA FSSSTAVDEA SISHIPVLSG FSVPKLVLQV VSVDSIFRIT
1360 1370 1380 1390 1400
SPSFNELVIL KDTAFSVYNK ARRISRGMPN DAFFSSSLPS RSSSALTPMN
1410 1420 1430 1440 1450
SISGIWKDCG GSRMTGSTHP RDGEIDVSLR TSGWDTSTSW QIPRSGGLSC
1460 1470 1480 1490 1500
DPNRNGDFYL NDEIFYLFEP LFILSEPGSV ERGVSPTFTS LGSESSKPIP
1510 1520 1530 1540 1550
EDGGRGSGPG MNSMEGITSG SSSQGDVSQL EGKAIPSLHC CYGWTEDWRW
1560 1570 1580 1590 1600
LVSIWTDARV LQQGCQILQA CSSPDNGSFK PRDFVITRIG NFFELEYQEW
1610 1620 1630 1640 1650
QKAIYSAGGP EIKKWPIQLR RSAPSGIATN SNGSSLQQQD LSLIQERASS
1660 1670 1680 1690 1700
TSTLYSSHSK QSTFVKGSMG QSAGRKQIMG GQTISGTPRG LFQWVHSISF
1710 1720 1730 1740 1750
ASISLDHSLH FVLPAELVSA GGGQSSTGMS SVNYIEGFTP VKSLGSTAFS
1760 1770 1780 1790 1800
YMMIPSPNMR FLHPSPLQLP TCLTAESPPL AHLLHSKGYA IPLSTGFVVS
1810 1820 1830 1840 1850
KAVPSMRKDS RINVKEEWPS VLSVSLIDYY GGYDNAHDKI LQGIVKQGGG
1860 1870 1880 1890 1900
TKETRDFEVE SHLILESIAA ELHALSWMTV SPAYLDRRTA LPFHCDMVLR
1910 1920
LRRLLHFADK EVSRIPDKTG V
Length:1,921
Mass (Da):208,462
Last modified:June 28, 2011 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i65425954D40C7C88
GO
Isoform 2 (identifier: F4I096-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     216-245: Missing.
     382-382: R → RFWLQNWIGPSLAGSSLFMHW
     1037-1056: Missing.
     1152-1171: GESTSLSFVKEVMLKHDRNW → VYETCR
     1559-1559: R → RGELLDTHIFPFGGISSRQDTKGLQCLFVQ
     1921-1921: V → LKVLTTDSGS...RPLSSMHHMA

Show »
Length:2,001
Mass (Da):217,269
Checksum:i0A4DA7D19CA8705B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1P8AV32A0A1P8AV32_ARATH
Mediator of RNA polymerase II trans...
GCT CCT, CENTER CITY, GRAND CENTRAL, MAB2, MACCHI-BOU 2
1,906Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAG51574 differs from that shown. Reason: Erroneous gene model prediction. The predicted gene At1g55325 has been split into 2 genes: At1g55320 and At1g55325.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_043977216 – 245Missing in isoform 2. CuratedAdd BLAST30
Alternative sequenceiVSP_043978382R → RFWLQNWIGPSLAGSSLFMH W in isoform 2. Curated1
Alternative sequenceiVSP_0439791037 – 1056Missing in isoform 2. CuratedAdd BLAST20
Alternative sequenceiVSP_0439801152 – 1171GESTS…HDRNW → VYETCR in isoform 2. CuratedAdd BLAST20
Alternative sequenceiVSP_0439811559R → RGELLDTHIFPFGGISSRQD TKGLQCLFVQ in isoform 2. Curated1
Alternative sequenceiVSP_0439821921V → LKVLTTDSGSQSLSMSLPRD HLDGICFQHTDCNFLRCCSP FLSGHIRRDGEQVNGQIKTA AIYYGVSLFPGKIDNLNAMV WSHSCCRPLSSMHHMA in isoform 2. Curated1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AC027034 Genomic DNA Translation: AAG51574.1 Sequence problems.
CP002684 Genomic DNA Translation: AEE33227.1
CP002684 Genomic DNA Translation: AEE33228.1

Protein sequence database of the Protein Information Resource

More...
PIRi
D96595

NCBI Reference Sequences

More...
RefSeqi
NP_001185237.1, NM_001198308.1 [F4I096-2]
NP_849809.2, NM_179478.2 [F4I096-1]

Genome annotation databases

Ensembl plant genome annotation project

More...
EnsemblPlantsi
AT1G55325.1; AT1G55325.1; AT1G55325 [F4I096-1]
AT1G55325.2; AT1G55325.2; AT1G55325 [F4I096-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
841978

Gramene; a comparative resource for plants

More...
Gramenei
AT1G55325.1; AT1G55325.1; AT1G55325 [F4I096-1]
AT1G55325.2; AT1G55325.2; AT1G55325 [F4I096-2]

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
ath:AT1G55325

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC027034 Genomic DNA Translation: AAG51574.1 Sequence problems.
CP002684 Genomic DNA Translation: AEE33227.1
CP002684 Genomic DNA Translation: AEE33228.1
PIRiD96595
RefSeqiNP_001185237.1, NM_001198308.1 [F4I096-2]
NP_849809.2, NM_179478.2 [F4I096-1]

3D structure databases

SMRiF4I096
ModBaseiSearch...

Protein-protein interaction databases

BioGridi27203, 1 interactor
STRINGi3702.AT1G55325.2

PTM databases

iPTMnetiF4I096

Proteomic databases

PRIDEiF4I096

Genome annotation databases

EnsemblPlantsiAT1G55325.1; AT1G55325.1; AT1G55325 [F4I096-1]
AT1G55325.2; AT1G55325.2; AT1G55325 [F4I096-2]
GeneIDi841978
GrameneiAT1G55325.1; AT1G55325.1; AT1G55325 [F4I096-1]
AT1G55325.2; AT1G55325.2; AT1G55325 [F4I096-2]
KEGGiath:AT1G55325

Organism-specific databases

AraportiAT1G55325
TAIRilocus:1005716738 AT1G55325

Phylogenomic databases

InParanoidiF4I096
KOiK15164
OMAiCRGRSNA
OrthoDBi19529at2759

Miscellaneous databases

Protein Ontology

More...
PROi
PR:F4I096

Gene expression databases

ExpressionAtlasiF4I096 baseline and differential
GenevisibleiF4I096 AT

Family and domain databases

InterProiView protein in InterPro
IPR021643 Mediator_Med13_N_met/fun
IPR041285 MID_MedPIWI
PfamiView protein in Pfam
PF11597 Med13_N, 1 hit
PF18296 MID_MedPIWI, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMED13_ARATH
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: F4I096
Secondary accession number(s): F4I095, Q9C8A3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 22, 2012
Last sequence update: June 28, 2011
Last modified: December 11, 2019
This is version 52 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again