Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 64 (29 Sep 2021)
Sequence version 2 (29 Oct 2014)
Previous versions | rss
Add a publicationFeedback
Protein

Protein CHROMATIN REMODELING 20

Gene

ATRX

Organism
Arabidopsis thaliana (Mouse-ear cress)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in transcriptional regulation and chromatin remodeling. Facilitates DNA replication in multiple cellular environments and is required for efficient replication of a subset of genomic loci. Binds to DNA tandem repeat sequences in both telomeres and euchromatin and in vitro binds DNA quadruplex structures. May help stabilizing G-rich regions into regular chromatin structures by remodeling G4 DNA and incorporating H3.3-containing nucleosomes (By similarity).

Involved in DNA repair of gamma-irradiation-mediated damages (PubMed:16547115).

By similarity1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri483 – 514GATA-type; atypicalPROSITE-ProRule annotationAdd BLAST32
Zinc fingeri524 – 577PHD-type; atypicalPROSITE-ProRule annotationAdd BLAST54
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi754 – 761ATPPROSITE-ProRule annotation8

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionChromatin regulator, DNA-binding, Helicase, Hydrolase
Biological processDNA damage, DNA repair, Transcription, Transcription regulation
LigandATP-binding, Metal-binding, Nucleotide-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein CHROMATIN REMODELING 201 Publication (EC:3.6.4.-)
Short name:
AtCHR20
Alternative name(s):
ATP-dependent helicase ATRXBy similarity
Transcriptional regulator ATRXBy similarity
X-linked helicase IIBy similarity
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ATRXImported
Synonyms:CHR201 Publication
Ordered Locus Names:At1g08600Imported
ORF Names:F22O13.8Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiArabidopsis thaliana (Mouse-ear cress)Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri3702 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaViridiplantaeStreptophytaEmbryophytaTracheophytaSpermatophytaMagnoliopsidaeudicotyledonsGunneridaePentapetalaerosidsmalvidsBrassicalesBrassicaceaeCamelineaeArabidopsis
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000006548 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Arabidopsis Information Portal

More...
Araporti
AT1G08600

The Arabidopsis Information Resource

More...
TAIRi
locus:2025560, AT1G08600

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Chromosome, Nucleus, Telomere

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Slight sensitivity to gamma-irradiation.1 Publication

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00004308571 – 1479Protein CHROMATIN REMODELING 20Add BLAST1479

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
F4HW51

PRoteomics IDEntifications database

More...
PRIDEi
F4HW51

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
246785 [F4HW51-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
F4HW51

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
F4HW51, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
F4HW51, AT

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
3702.AT1G08600.4

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
F4HW51

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini472 – 601ADDPROSITE-ProRule annotationAdd BLAST130
Domaini741 – 924Helicase ATP-bindingPROSITE-ProRule annotationAdd BLAST184
Domaini1122 – 1290Helicase C-terminalPROSITE-ProRule annotationAdd BLAST169

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni40 – 109DisorderedSequence analysisAdd BLAST70
Regioni594 – 615DisorderedSequence analysisAdd BLAST22
Regioni1400 – 1423DisorderedSequence analysisAdd BLAST24

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili19 – 49Sequence analysisAdd BLAST31
Coiled coili109 – 199Sequence analysisAdd BLAST91
Coiled coili578 – 598Sequence analysisAdd BLAST21

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi875 – 878DEAH boxPROSITE-ProRule annotation4

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi40 – 57Basic and acidic residuesSequence analysisAdd BLAST18
Compositional biasi64 – 104Basic and acidic residuesSequence analysisAdd BLAST41
Compositional biasi599 – 615Polar residuesSequence analysisAdd BLAST17

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The ADD domain predominantly interacts with histone H3 trimethylated at 'Lys-10'(H3K9me3) (and to a lesser extent H3 mono- or dimethylated at 'Lys-10') and simultanously to histone H3 unmethylated at 'Lys-5' (H3K4me0). The interaction with H3K9me3 is disrupted by the presence of H3K4me3 suggesting a readout of the combined histone H3 methylation state.By similarity

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the SNF2/RAD54 helicase family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri483 – 514GATA-type; atypicalPROSITE-ProRule annotationAdd BLAST32
Zinc fingeri524 – 577PHD-type; atypicalPROSITE-ProRule annotationAdd BLAST54

Keywords - Domaini

Coiled coil, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1015, Eukaryota

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_002089_0_0_1

Identification of Orthologs from Complete Genome Data

More...
OMAi
VPNVCET

Family and domain databases

Conserved Domains Database

More...
CDDi
cd18069, DEXHc_ARIP4, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.50.10810, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR025766, ADD
IPR044574, ARIP4-like
IPR044573, ARIP4_DEXHc
IPR014001, Helicase_ATP-bd
IPR001650, Helicase_C
IPR027417, P-loop_NTPase
IPR038718, SNF2-like_sf
IPR000330, SNF2_N

The PANTHER Classification System

More...
PANTHERi
PTHR45797, PTHR45797, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00271, Helicase_C, 1 hit
PF00176, SNF2_N, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00487, DEXDc, 1 hit
SM00490, HELICc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52540, SSF52540, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51533, ADD, 1 hit
PS51192, HELICASE_ATP_BIND_1, 1 hit
PS51194, HELICASE_CTER, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: F4HW51-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEANEESLKG KIEKLEGKEV IVESKEDEMD IIIEENREAE QEVMEVKARD
60 70 80 90 100
GRGEQNDVLM EENNNQGEQK DEEMQDASSR SESSDFNSDE DEQILSRRDD
110 120 130 140 150
ELDLEKPLSE EEIDELISDL LAVESKAAEA QEALEKESLS KVESEVREEL
160 170 180 190 200
AQALRGDELD EAVAAEMMTF KDEWEATLDE LETESATLLE QLDGAGIELP
210 220 230 240 250
KLYEMIESQA PNGCYTEAWK QRAHWVGTQV TKETVESLAN AERFLHTHRP
260 270 280 290 300
VRKRHGKLLE EGASGFLEKK LADGAVKESL AGTSELDWSS LNKVFSEKRD
310 320 330 340 350
ESVSFGSKQW ASVYLASTPH QAAAMGLEFP GVNEVEEIEE IDASLADPFL
360 370 380 390 400
ADAIDNEREL ALTEEQKTNY IRVKEEDDIT CDRVLQLRLK RKRRKKRSKQ
410 420 430 440 450
VIRCAAENMD DDSVYLDGNN TTPNFAKDQV KSPETSTQVH NSEVNIEENG
460 470 480 490 500
NFSNSDVDKM TPSTHINVDA KRDDSQNPAN NFRCTACNKV AVEVHSHPLL
510 520 530 540 550
EVIVCMDCKR SIEDRVSKVD DSLERHCEWC GHIADLIDCR TCEKLFCASC
560 570 580 590 600
IKRNIGEEYM SEAQSSGWDC CCCSPIPLQR LTLELEKAMR DKKSIELSSD
610 620 630 640 650
SSSDSSSDNN SVDTDADVNV TISSKKKSKK KIRRIIDDAE LGKDTRTKIA
660 670 680 690 700
IEKARQERLR SLQFSARYKT ISSMGDVKSI PEGAEVEVLG DAHSGYIVNV
710 720 730 740 750
VREIGEEAVR VPRSISAKLK VHQVTGIRFM WENIIQSISR VKSGDKGLGC
760 770 780 790 800
ILAHTMGLGK TFQVIAFLYT AMRCVDLGLK TALIVTPVNV LHNWRSEFEK
810 820 830 840 850
WMPSEVKPLR IFMLGDVSRE RRFDLLTKWR KKGGVFLMGY TNFRNLSLGR
860 870 880 890 900
GVKDLNAARG ICNALRDGPD ILVCDEAHII KNTKADTTQA LKQVKCQRRI
910 920 930 940 950
ALTGSPLQNN LMEYYCMVDF VREGFLGSSP EFRNRFQNPI ENGQHMNSTA
960 970 980 990 1000
EDVKIMNQRS HILYEQLKGF VQRMDMNVVK KDLPPKTVFV ISVKLSPLQR
1010 1020 1030 1040 1050
ILYQRFLELY GFSDGRTDER MRKNFFAAYQ VLAQILNHPG IPQLRSEDSK
1060 1070 1080 1090 1100
NGRRGSIVDI PDDCSSDENI DYNMVTGEKQ RTMNDLQDKV DGYLQKDWWV
1110 1120 1130 1140 1150
DLLQKNNYKV SDFSGKMILL LDILSMSADV GDKALVFSQS IPTLDLIELY
1160 1170 1180 1190 1200
LSRVPRHGKQ GKFWKKGKDW YRIDGKTESS ERQKLVDRFN EPDNKRVKCT
1210 1220 1230 1240 1250
LISTRAGSLG INLYAANRVI IVDGSWNPTY DLQAIFRAWR YGQKKPVFAY
1260 1270 1280 1290 1300
RLMARGTIEE KIYKRQVTKE GLAARVVDRQ QVHRTISKEE MLHLFEFDDD
1310 1320 1330 1340 1350
DEKSEAVTEI SKQNEAGHSN LVEQAILWTK KATLSRVGGD KLMENLLQRH
1360 1370 1380 1390 1400
GPNWISSFHE HETLLQENEE ERLTKEEKDM AWEVYRRALE WEEVQRVPFS
1410 1420 1430 1440 1450
ESPVVPKPSP STQTEPLPQP KGFNRSRFVN RNCTRIAHQL TLISQGLKVG
1460 1470
SSTVCGECGR VIRWEDVIPA SKLSAVIVN
Length:1,479
Mass (Da):168,176
Last modified:October 29, 2014 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i38097CF3BD412F3B
GO
Isoform 2 (identifier: F4HW51-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     820-850: ERRFDLLTKWRKKGGVFLMGYTNFRNLSLGR → YKFFYERNFW

Show »
Length:1,458
Mass (Da):165,915
Checksum:i98CDCCA4134C0DF6
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAB51700 differs from that shown. Reason: Frameshift.Curated
The sequence AAF99756 differs from that shown. Reason: Erroneous gene model prediction.

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_057103820 – 850ERRFD…LSLGR → YKFFYERNFW in isoform 2. Add BLAST31

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AC003981 Genomic DNA Translation: AAF99756.1 Sequence problems.
CP002684 Genomic DNA Translation: AEE28313.1
CP002684 Genomic DNA Translation: AEE28314.1
CP002684 Genomic DNA Translation: AEE28315.1
CP002684 Genomic DNA Translation: AEE28316.1
U75593 mRNA Translation: AAB51700.1 Frameshift.

Protein sequence database of the Protein Information Resource

More...
PIRi
F86218
T00713

NCBI Reference Sequences

More...
RefSeqi
NP_001184937.1, NM_001198008.2 [F4HW51-1]
NP_001184938.1, NM_001198009.1 [F4HW51-1]
NP_001184939.1, NM_001198010.1 [F4HW51-1]
NP_172336.4, NM_100733.5 [F4HW51-2]

Genome annotation databases

Ensembl plant genome annotation project

More...
EnsemblPlantsi
AT1G08600.1; AT1G08600.1; AT1G08600 [F4HW51-2]
AT1G08600.2; AT1G08600.2; AT1G08600 [F4HW51-1]
AT1G08600.3; AT1G08600.3; AT1G08600 [F4HW51-1]
AT1G08600.4; AT1G08600.4; AT1G08600 [F4HW51-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
837382

Gramene; a comparative resource for plants

More...
Gramenei
AT1G08600.1; AT1G08600.1; AT1G08600 [F4HW51-2]
AT1G08600.2; AT1G08600.2; AT1G08600 [F4HW51-1]
AT1G08600.3; AT1G08600.3; AT1G08600 [F4HW51-1]
AT1G08600.4; AT1G08600.4; AT1G08600 [F4HW51-1]

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
ath:AT1G08600

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC003981 Genomic DNA Translation: AAF99756.1 Sequence problems.
CP002684 Genomic DNA Translation: AEE28313.1
CP002684 Genomic DNA Translation: AEE28314.1
CP002684 Genomic DNA Translation: AEE28315.1
CP002684 Genomic DNA Translation: AEE28316.1
U75593 mRNA Translation: AAB51700.1 Frameshift.
PIRiF86218
T00713
RefSeqiNP_001184937.1, NM_001198008.2 [F4HW51-1]
NP_001184938.1, NM_001198009.1 [F4HW51-1]
NP_001184939.1, NM_001198010.1 [F4HW51-1]
NP_172336.4, NM_100733.5 [F4HW51-2]

3D structure databases

SMRiF4HW51
ModBaseiSearch...

Protein-protein interaction databases

STRINGi3702.AT1G08600.4

PTM databases

iPTMnetiF4HW51

Proteomic databases

PaxDbiF4HW51
PRIDEiF4HW51
ProteomicsDBi246785 [F4HW51-1]

Genome annotation databases

EnsemblPlantsiAT1G08600.1; AT1G08600.1; AT1G08600 [F4HW51-2]
AT1G08600.2; AT1G08600.2; AT1G08600 [F4HW51-1]
AT1G08600.3; AT1G08600.3; AT1G08600 [F4HW51-1]
AT1G08600.4; AT1G08600.4; AT1G08600 [F4HW51-1]
GeneIDi837382
GrameneiAT1G08600.1; AT1G08600.1; AT1G08600 [F4HW51-2]
AT1G08600.2; AT1G08600.2; AT1G08600 [F4HW51-1]
AT1G08600.3; AT1G08600.3; AT1G08600 [F4HW51-1]
AT1G08600.4; AT1G08600.4; AT1G08600 [F4HW51-1]
KEGGiath:AT1G08600

Organism-specific databases

AraportiAT1G08600
TAIRilocus:2025560, AT1G08600

Phylogenomic databases

eggNOGiKOG1015, Eukaryota
HOGENOMiCLU_002089_0_0_1
OMAiVPNVCET

Miscellaneous databases

Protein Ontology

More...
PROi
PR:F4HW51

Gene expression databases

ExpressionAtlasiF4HW51, baseline and differential
GenevisibleiF4HW51, AT

Family and domain databases

CDDicd18069, DEXHc_ARIP4, 1 hit
Gene3Di3.40.50.10810, 1 hit
InterProiView protein in InterPro
IPR025766, ADD
IPR044574, ARIP4-like
IPR044573, ARIP4_DEXHc
IPR014001, Helicase_ATP-bd
IPR001650, Helicase_C
IPR027417, P-loop_NTPase
IPR038718, SNF2-like_sf
IPR000330, SNF2_N
PANTHERiPTHR45797, PTHR45797, 1 hit
PfamiView protein in Pfam
PF00271, Helicase_C, 1 hit
PF00176, SNF2_N, 1 hit
SMARTiView protein in SMART
SM00487, DEXDc, 1 hit
SM00490, HELICc, 1 hit
SUPFAMiSSF52540, SSF52540, 2 hits
PROSITEiView protein in PROSITE
PS51533, ADD, 1 hit
PS51192, HELICASE_ATP_BIND_1, 1 hit
PS51194, HELICASE_CTER, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCHR20_ARATH
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: F4HW51
Secondary accession number(s): F4HW52, O04048, Q9FRS5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 29, 2014
Last sequence update: October 29, 2014
Last modified: September 29, 2021
This is version 64 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programPlant Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Arabidopsis thaliana
    Arabidopsis thaliana: entries and gene names
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again