UniProtKB - E9PRQ8 (E9PRQ8_HUMAN)

BLAST

>tr|E9PRQ8|E9PRQ8_HUMAN EGF-containing fibulin-like extracellular matrix protein 2 (Fragment) OS=Homo sapiens OX=9606 GN=EFEMP2 PE=1 SV=1
MLPCASCLPGSLLLWALLLLLLGSASPQDSEEPDSYTECTDGYEWDPDSQHCRDVNECLT
IPEACKGEMKCINHYGGYLCLPRSAAVINDLHGEGPPPPVPPAQHPNPCPPGYEPDDQDS
CVDVDECAQALHDCRPSQDCHNLPGSYQCTCPDGYRKIGPECVDIDECRYRYCQHRCVNL
PGS

Align
Format
Add to basket Added to basket
History
Entry version 58 (12 Sep 2018)
Sequence version 1 (05 Apr 2011)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Submitted name:

EGF-containing fibulin-like extracellular matrix protein 2

Gene

EFEMP2

Organism

Homo sapiens (Human)

Status

Unreviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Caution

Lacks conserved residue(s) required for the propagation of feature annotation.PROSITE-ProRule annotation

GO - Molecular functionⁱ

calcium ion binding Source: InterPro

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

elastic fiber assembly Source: InterPro

View the complete GO annotation on QuickGO ...

Names & Taxonomyⁱ

Protein namesⁱ	Submitted name: EGF-containing fibulin-like extracellular matrix protein 2Imported
Gene namesⁱ	Name:EFEMP2Imported
Organismⁱ	Homo sapiens (Human)Imported
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 11

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000172638.12
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:3219 EFEMP2

Subcellular locationⁱ

GO - Cellular component

Pathology & Biotechⁱ

Organism-specific databases

Open Targets More...OpenTargetsⁱ	ENSG00000172638

OpenTargetsⁱ

ENSG00000172638

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Signal peptideⁱ	1 – 27	Sequence analysisAdd BLAST		27
ChainⁱPRO_5003244191	28 – 183	Sequence analysisAdd BLAST		156

Keywords - PTMⁱ

Disulfide bondSAAS annotation

Proteomic databases

PeptideAtlas More...PeptideAtlasⁱ	E9PRQ8
PRIDEⁱ	E9PRQ8

Expressionⁱ

Gene expression databases

Bgeeⁱ	ENSG00000172638 Expressed in 230 organ(s), highest expression level in tendon of biceps brachii
ExpressionAtlasⁱ	E9PRQ8 baseline and differential

Structureⁱ

3D structure databases

ProteinModelPortalⁱ	E9PRQ8
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Domainⁱ	123 – 163	EGF-likeInterPro annotationAdd BLAST		41

Keywords - Domainⁱ

EGF-like domainPROSITE-ProRule annotationSAAS annotation, RepeatSAAS annotation, SignalSequence analysis

Phylogenomic databases

eggNOGⁱ	ENOG410IR6U Eukaryota ENOG410ZNNG LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00760000118806

Family and domain databases

InterProⁱ	View protein in InterPro IPR026824 Efemp2 IPR001881 EGF-like_Ca-bd_dom IPR013032 EGF-like_CS IPR000742 EGF-like_dom IPR000152 EGF-type_Asp/Asn_hydroxyl_site IPR018097 EGF_Ca-bd_CS IPR037287 Fibulin_3/4/5 IPR009030 Growth_fac_rcpt_cys_sf
PANTHERⁱ	PTHR44074 PTHR44074, 1 hit PTHR44074:SF3 PTHR44074:SF3, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF07645 EGF_CA, 2 hits
SMARTⁱ	View protein in SMART SM00181 EGF, 1 hit SM00179 EGF_CA, 3 hits
SUPFAMⁱ	SSF57184 SSF57184, 1 hit
PROSITEⁱ	View protein in PROSITE PS00010 ASX_HYDROXYL, 1 hit PS01186 EGF_2, 1 hit PS50026 EGF_3, 1 hit PS01187 EGF_CA, 1 hit

Sequence (1+)ⁱ

Sequence statusⁱ: Fragment.

This entry has 1 described isoform and 10 potential isoforms that are computationally mapped.Show all Align All

E9PRQ8-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MLPCASCLPG SLLLWALLLL LLGSASPQDS EEPDSYTECT DGYEWDPDSQ 
        60         70         80         90        100
HCRDVNECLT IPEACKGEMK CINHYGGYLC LPRSAAVIND LHGEGPPPPV 
       110        120        130        140        150
PPAQHPNPCP PGYEPDDQDS CVDVDECAQA LHDCRPSQDC HNLPGSYQCT 
       160        170        180 
CPDGYRKIGP ECVDIDECRY RYCQHRCVNL PGS

Length:183

Mass (Da):20,095

Last modified:April 5, 2011 - v1

Checksum:ⁱ661C7B0967499D54

Computationally mapped potential isoform sequencesⁱ

There are 10 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

O95967	FBLN4_HUMAN	EGF-containing fibulin-like extrace... EGF-containing fibulin-like extracellular matrix protein 2 (Fibulin-4, FIBL-4) (Protein UPH1)	EFEMP2 FBLN4, UNQ200/PRO226	443	Annotation score:
E9PRU1	E9PRU1_HUMAN	EGF-containing fibulin-like extrace... EGF-containing fibulin-like extracellular matrix protein 2	EFEMP2	436	Annotation score:
E9PKA3	E9PKA3_HUMAN	EGF-containing fibulin-like extrace... EGF-containing fibulin-like extracellular matrix protein 2	EFEMP2	202	Annotation score:
E9PSC1	E9PSC1_HUMAN	EGF-containing fibulin-like extrace... EGF-containing fibulin-like extracellular matrix protein 2	EFEMP2	77	Annotation score:
H0YET5	H0YET5_HUMAN	EGF-containing fibulin-like extrace... EGF-containing fibulin-like extracellular matrix protein 2	EFEMP2	182	Annotation score:
H0YEU0	H0YEU0_HUMAN	EGF-containing fibulin-like extrace... EGF-containing fibulin-like extracellular matrix protein 2	EFEMP2	74	Annotation score:
E9PI47	E9PI47_HUMAN	EGF-containing fibulin-like extrace... EGF-containing fibulin-like extracellular matrix protein 2	EFEMP2	76	Annotation score:
H0YCR9	H0YCR9_HUMAN	EGF-containing fibulin-like extrace... EGF-containing fibulin-like extracellular matrix protein 2	EFEMP2	69	Annotation score:
H0YCB5	H0YCB5_HUMAN	EGF-containing fibulin-like extrace... EGF-containing fibulin-like extracellular matrix protein 2	EFEMP2	54	Annotation score:
E9PNB8	E9PNB8_HUMAN	EGF-containing fibulin-like extrace... EGF-containing fibulin-like extracellular matrix protein 2	EFEMP2	58	Annotation score:

Experimental Info

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Non-terminal residueⁱ	183	Imported		1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AP001201 Genomic DNA No translation available.

Select the link destinations:
EMBLⁱ
GenBankⁱ
DDBJⁱ

Links Updated

AP001201 Genomic DNA No translation available.

Genome annotation databases

Ensemblⁱ	ENST00000527378; ENSP00000435963; ENSG00000172638
UCSC genome browser More...UCSCⁱ	uc058drc.1 human

Protein	Similar proteins		Species	Score	Length	Source
E9PRQ8	EGF-containing fibulin-like extracellular matrix protein 2	)	HUMAN		443	UniRef100_O95967
EGF-containing fibulin-like extracellular matrix protein 2, isoform CRA_a		HUMAN		443
EGF-containing fibulin-like extracellular matrix protein 2 (Fragment)		HUMAN		202

Protein	Similar proteins		Species	Score	Length	Source
E9PRQ8	EGF-containing fibulin-like extracellular matrix protein 2	)	HUMAN		443	UniRef90_O95967
EGF-containing fibulin-like extracellular matrix protein 2		CRIGR		443
EGF-containing fibulin-like extracellular matrix protein 2		Yangtze finless porpoise		449
EGF containing fibulin extracellular matrix protein 2		CANLF		446
EGF containing fibulin extracellular matrix protein 2		AILME		446
+77

Protein	Similar proteins		Species	Score	Length	Source
E9PRQ8	EGF-containing fibulin-like extracellular matrix protein 2	)	HUMAN		443	UniRef50_O95967
EGF-containing fibulin-like extracellular matrix protein 2		CRIGR		443
EGF-containing fibulin-like extracellular matrix protein 2		Yangtze finless porpoise		449
EGF containing fibulin extracellular matrix protein 2		AILME		446
EGF containing fibulin extracellular matrix protein 2		CANLF		446
+159

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AP001201 Genomic DNA No translation available.

Select the link destinations:
EMBLⁱ
GenBankⁱ
DDBJⁱ

Links Updated

AP001201 Genomic DNA No translation available.

3D structure databases

ProteinModelPortalⁱ	E9PRQ8
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Proteomic databases

PeptideAtlasⁱ	E9PRQ8
PRIDEⁱ	E9PRQ8

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

Ensemblⁱ	ENST00000527378; ENSP00000435963; ENSG00000172638
UCSCⁱ	uc058drc.1 human

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000172638.12
HGNCⁱ	HGNC:3219 EFEMP2
OpenTargetsⁱ	ENSG00000172638
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	ENOG410IR6U Eukaryota ENOG410ZNNG LUCA
GeneTreeⁱ	ENSGT00760000118806

Gene expression databases

Bgeeⁱ	ENSG00000172638 Expressed in 230 organ(s), highest expression level in tendon of biceps brachii
ExpressionAtlasⁱ	E9PRQ8 baseline and differential

Family and domain databases

InterProⁱ	View protein in InterPro IPR026824 Efemp2 IPR001881 EGF-like_Ca-bd_dom IPR013032 EGF-like_CS IPR000742 EGF-like_dom IPR000152 EGF-type_Asp/Asn_hydroxyl_site IPR018097 EGF_Ca-bd_CS IPR037287 Fibulin_3/4/5 IPR009030 Growth_fac_rcpt_cys_sf
PANTHERⁱ	PTHR44074 PTHR44074, 1 hit PTHR44074:SF3 PTHR44074:SF3, 1 hit
Pfamⁱ	View protein in Pfam PF07645 EGF_CA, 2 hits
SMARTⁱ	View protein in SMART SM00181 EGF, 1 hit SM00179 EGF_CA, 3 hits
SUPFAMⁱ	SSF57184 SSF57184, 1 hit
PROSITEⁱ	View protein in PROSITE PS00010 ASX_HYDROXYL, 1 hit PS01186 EGF_2, 1 hit PS50026 EGF_3, 1 hit PS01187 EGF_CA, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	E9PRQ8_HUMAN
Accessionⁱ	E9PRQ8Primary (citable) accession number: E9PRQ8
Entry historyⁱ	Integrated into UniProtKB/TrEMBL:	April 5, 2011
	Last sequence update:	April 5, 2011
	Last modified:	September 12, 2018
	This is version 58 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Unreviewed (UniProtKB/TrEMBL)
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

Complete proteome, Proteomics identificationCombined sources, Reference proteomeImported

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - E9PRQ8 (E9PRQ8_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

EGF-containing fibulin-like extracellular matrix protein 2

EFEMP2

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Caution

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Proteomic databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Keywords - Domaini

Phylogenomic databases

Family and domain databases

Experimental Info

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Expressionⁱ

Structureⁱ

Family & Domainsⁱ

Keywords - Domainⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ