Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 102 (02 Jun 2021)
Sequence version 2 (01 Apr 2015)
Previous versions | rss
Add a publicationFeedback
Protein

PH and SEC7 domain-containing protein

Gene

Efa6

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Guanine nucleotide exchange factor for Arf6 (PubMed:28607459).

Regulates axon growth and branching by inhibiting microtubule polymerisation at the cortex (PubMed:31718774).

Together with shot, promotes axonal microtubule bundle integrity (PubMed:31718774).

Required for normal ethanol-induced tolerance and preference (PubMed:28607459).

Probably by activating Arf6, counteracts ethanol-induced sedation (PubMed:28607459).

2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGuanine-nucleotide releasing factor

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
PH and SEC7 domain-containing proteinCurated
Alternative name(s):
Exchange factor for ADP-ribosylation factor guanine nucleotide factor 61 PublicationImported
Short name:
Exchange factor for Arf 61 PublicationImported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Efa61 PublicationImported
Synonyms:CG18185Imported, CG6941Imported, dPsd1 PublicationImported
ORF Names:CG31158Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraEndopterygotaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3R

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0051158, Efa6

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell membrane, Cell projection, Cytoplasm, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Viable but male sterile (PubMed:28607459). Results in enhances preference and sensitivity to ethanol (PubMed:28607459). Fails to develop tolerance to repeated ethanol exposures (PubMed:28607459). Increases axon length and axon branching (PubMed:31718774). RNAi-mediated knockdown increases axon length and axon branching (PubMed:31718774). RNAi-mediated knockdown in a subset of lamina neurons results in axonal swellings and disorganized axonal microtubules (PubMed:31718774).2 Publications

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi233 – 236SRIP → AAAA: Depletion of microtubule network leading to axon loss; when associated with 262-A--A-265. 1 Publication4
Mutagenesisi262 – 265SQIP → AAAA: Depletion of microtubule network leading to axon loss; when associated with 233-A--A-236. 1 Publication4

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00004492501 – 1601PH and SEC7 domain-containing proteinCuratedAdd BLAST1601

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
A8JR81

PRoteomics IDEntifications database

More...
PRIDEi
E1JIT7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in the head (at protein level).2 Publications

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed throughout the central nervous system at larval and adult stages.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
FBgn0051158, Expressed in cleaving embryo and 35 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
E1JIT7, baseline and differential

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (via MTED motif) with tubulin.

1 Publication

GO - Molecular functioni

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
E1JIT7

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini6 – 88PDZPROSITE-ProRule annotationAdd BLAST83
Domaini1125 – 1291SEC7PROSITE-ProRule annotationAdd BLAST167
Domaini1332 – 1445PHPROSITE-ProRule annotationAdd BLAST114

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 340Mediates regulation of axon branching and microtubule organization1 PublicationAdd BLAST340
Regioni113 – 192DisorderedSequence analysisAdd BLAST80
Regioni211 – 322DisorderedSequence analysisAdd BLAST112
Regioni339 – 440DisorderedSequence analysisAdd BLAST102
Regioni458 – 657DisorderedSequence analysisAdd BLAST200
Regioni737 – 780DisorderedSequence analysisAdd BLAST44
Regioni872 – 965DisorderedSequence analysisAdd BLAST94
Regioni894 – 1601Mediates association to the membrane and rescricts the microtubule-inhibiting activity to the cell cortex1 PublicationAdd BLAST708
Regioni1040 – 1126DisorderedSequence analysisAdd BLAST87
Regioni1544 – 1601DisorderedSequence analysisAdd BLAST58

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi323 – 340Microtubule elimination domain (MTED); Binds tubulin and blocks microtubule polymerization1 PublicationAdd BLAST18

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi256 – 297Polar residuesSequence analysisAdd BLAST42
Compositional biasi378 – 440Polar residuesSequence analysisAdd BLAST63
Compositional biasi470 – 486Polar residuesSequence analysisAdd BLAST17
Compositional biasi490 – 505Acidic residuesSequence analysisAdd BLAST16
Compositional biasi532 – 555Acidic residuesSequence analysisAdd BLAST24
Compositional biasi556 – 608Polar residuesSequence analysisAdd BLAST53
Compositional biasi617 – 655Polar residuesSequence analysisAdd BLAST39
Compositional biasi872 – 948Polar residuesSequence analysisAdd BLAST77
Compositional biasi1050 – 1072Basic and acidic residuesSequence analysisAdd BLAST23
Compositional biasi1076 – 1094Polar residuesSequence analysisAdd BLAST19
Compositional biasi1567 – 1590Polar residuesSequence analysisAdd BLAST24

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the PSD family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0932, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155061

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_005163_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
A8JR81

Identification of Orthologs from Complete Genome Data

More...
OMAi
MNRKMSC

Database of Orthologous Groups

More...
OrthoDBi
274195at2759

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00171, Sec7, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.1000.11, 1 hit
2.30.29.30, 1 hit
2.30.42.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001478, PDZ
IPR041489, PDZ_6
IPR036034, PDZ_sf
IPR011993, PH-like_dom_sf
IPR041681, PH_9
IPR001605, PH_dom-spectrin-type
IPR001849, PH_domain
IPR023394, Sec7_C_sf
IPR000904, Sec7_dom
IPR035999, Sec7_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF17820, PDZ_6, 1 hit
PF15410, PH_9, 1 hit
PF01369, Sec7, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00683, SPECTRINPH

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00228, PDZ, 1 hit
SM00233, PH, 1 hit
SM00222, Sec7, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48425, SSF48425, 1 hit
SSF50156, SSF50156, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50106, PDZ, 1 hit
PS50003, PH_DOMAIN, 1 hit
PS50190, SEC7, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform HImported (identifier: E1JIT7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSEELKVVLR RSEQHSGFGF SLLGTTGPPH VIYDIVENSP AADCGAVEAG
60 70 80 90 100
DVILKVNGTD VHRYTTKEVL KCLRLSEQLV TLELKRDPKL KARIKEQLAN
110 120 130 140 150
TQSPHYVDIE SPNIYDYHSS STNSSPNHRP NAGGKGAATT PSQTGLRYKS
160 170 180 190 200
PTHLPSLRQN SSPLLASGST TTTTTATHTH SHSRNSSASS TKIKVVETSI
210 220 230 240 250
TTSTTNVVGL TSPTGSVGGG VGGEATSPTF RPSRIPQALT KCAVPKPVPV
260 270 280 290 300
LHSPQNKRPR PSQIPTKAAN GNGNGHTAHL PPQSLQHSNS YSGSPVTRQR
310 320 330 340 350
FADREPEREP EPNSAPPQPA KAPRFEAYMM TGDLILNLSR TPQTSNPLPA
360 370 380 390 400
QAKKIDSLRD SPSRLVNPRI NGALAPRASG ESSPTSSSSV DSPTNTSSDS
410 420 430 440 450
VKREAKLLQK QQQQQQQTYQ QQQQRDSINN SYNRKDSLTN DTLLMCEELE
460 470 480 490 500
PDEEGEYVLE EDNKQQRQRQ QQQRYRQQQN QQRYEYYQNE DELEEQEEVE
510 520 530 540 550
EEREEDQTHY DITNIETYQS GVGRGDDDDS DRQCLVDDDD DDDAYDDEEN
560 570 580 590 600
DAGDEDYSTN SLGSGSAKQR LRALKQRTAT RQQQRNRDAV DCAGRSGSGS
610 620 630 640 650
SSTTVKSEAG GLGLDETSFS VPTSPISLST PLIDKETANS VPTSPEPSSL
660 670 680 690 700
VPESSSGAGA GAVVVRRHNG HVVRKCDAAG FRTSKSEDHL QQIQREGIAA
710 720 730 740 750
VIPIDIDEDV NSSLNTLLDT RQDSEDSQSM ATVIVNNSSL ASNNNEGEQT
760 770 780 790 800
DNRSSSSSSN SSDNNNCSSN TGEPATSETA TATATIITAT STRTMNCSSK
810 820 830 840 850
LNYILCKKAS DRDRIVWTYN APLQPHQLAA LQRQQQQQEQ QFQQQQQQLH
860 870 880 890 900
QQHLQQQQQL QQQHQQQQQQ QQQQQQQQLY GQQSHSNSHS SSISSSPQHS
910 920 930 940 950
AVGSPASPTS VSSSVMSSSG SKGALGLGSS SNGPMAAVQQ QQLREREQGG
960 970 980 990 1000
QVAQPPSGIP GLLSCPGGGC GNNGGGGGIG GGGNNDQSVS EAISNISSPD
1010 1020 1030 1040 1050
YQDDDNLLSS RDILGGMVLS DPSDSDSTIL VSDAAAHQRQ QLKQQLRAQQ
1060 1070 1080 1090 1100
QQQRERERDR DRDREQSEHK VVIQVRGLDS NSSGGNGTNG RSEEDVVTLT
1110 1120 1130 1140 1150
DEPLGTMTVG MRDASPPVSD DGSDVESLHS YHYSPKAVDM PSAIRLAKRL
1160 1170 1180 1190 1200
HSLDGFKKSD VSRHLSKNND FSRAVADEYL KHFTFEKKSL DQALREFLQQ
1210 1220 1230 1240 1250
FSLSGETQER ERVLVHFSKR FLDCNPGTFN SQDAVHTLTC AIMLLNTDLH
1260 1270 1280 1290 1300
GQNINRKMSC AEFVDNLADL NDGENFPKDV LKSLYQAIKT KPLEWALDEE
1310 1320 1330 1340 1350
AGDLQQQRAN NSALGNVGLN PFLDPPELAT AVEYKKGYVM RKCCYDSSFK
1360 1370 1380 1390 1400
KTPFGKRSWK MFYCTLRDLV LYLHKDEHGF RKSQMSDNLH NAIRIHHALA
1410 1420 1430 1440 1450
TKANDYTKKQ HVFRLQTADQ AEYLFQTSDS KELQSWVETI NYVCAAISAP
1460 1470 1480 1490 1500
PLEGGVGSQK RFQRPLLPSK QSKLMLKEQL DSHEVQLAQL DQELNEHKKG
1510 1520 1530 1540 1550
PIPSKGLALQ NYKEKESYLQ YELRRYRTYV SILSAKMLAD QQQLELQAQQ
1560 1570 1580 1590 1600
PSPASHEEEA DTFPVGTTAC TPPTPQSINQ KDQQKEQQQQ QPTNRKEKKK

K
Length:1,601
Mass (Da):176,440
Last modified:April 1, 2015 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF39FC9D187C83B72
GO
Isoform CImported (identifier: E1JIT7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     729-808: Missing.
     881-1014: Missing.

Show »
Length:1,387
Mass (Da):155,195
Checksum:i5CCA5AA60591A55B
GO
Isoform DImported (identifier: E1JIT7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     729-808: Missing.

Show »
Length:1,521
Mass (Da):168,171
Checksum:i00614ED95C7E5C41
GO
Isoform GImported (identifier: E1JIT7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     729-808: Missing.
     881-1014: Missing.
     1596-1601: KEKKKK → WFDVFCCCCPLWRHLIHSKSH

Show »
Length:1,402
Mass (Da):157,025
Checksum:i5AFBF84FBCB7F72F
GO
Isoform IImported (identifier: E1JIT7-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     729-808: Missing.
     1595-1601: RKEKKKK → SPPRISVSTNLAWRKIFWDSVCCGVLLCCWHYCTVLTVIP

Show »
Length:1,554
Mass (Da):171,795
Checksum:i31935352FE4F31AC
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti410K → KQ in ABX00730 (Ref. 4) Curated1
Sequence conflicti444L → V in ABX00730 (Ref. 4) Curated1
Sequence conflicti622P → S in ABX00730 (Ref. 4) Curated1
Sequence conflicti1106T → M in AAM51104 (PubMed:12537569).Curated1
Sequence conflicti1106T → M in ABX00730 (Ref. 4) Curated1
Sequence conflicti1366L → V in ABX00730 (Ref. 4) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_060537729 – 808Missing in isoform C, isoform D, isoform G and isoform I. CuratedAdd BLAST80
Alternative sequenceiVSP_060539881 – 1014Missing in isoform C and isoform G. CuratedAdd BLAST134
Alternative sequenceiVSP_0605401595 – 1601RKEKKKK → SPPRISVSTNLAWRKIFWDS VCCGVLLCCWHYCTVLTVIP in isoform I. Curated7
Alternative sequenceiVSP_0605411596 – 1601KEKKKK → WFDVFCCCCPLWRHLIHSKS H in isoform G. Curated6

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AE014297 Genomic DNA Translation: AAF56027.4
AE014297 Genomic DNA Translation: AAO41590.3
AE014297 Genomic DNA Translation: ABW08731.1
AE014297 Genomic DNA Translation: ABW08732.1
AE014297 Genomic DNA Translation: ACZ94987.2
AY119244 mRNA Translation: AAM51104.1
BT031108 mRNA Translation: ABX00730.1
BT072828 mRNA Translation: ACN62431.1

NCBI Reference Sequences

More...
RefSeqi
NP_001097873.1, NM_001104403.2 [E1JIT7-2]
NP_001097874.1, NM_001104404.2 [E1JIT7-3]
NP_001163691.2, NM_001170220.2 [E1JIT7-1]
NP_732769.3, NM_170027.4 [E1JIT7-4]
NP_788718.3, NM_176541.3 [E1JIT7-5]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0113395; FBpp0112307; FBgn0051158 [E1JIT7-2]
FBtr0113396; FBpp0112308; FBgn0051158 [E1JIT7-3]
FBtr0302187; FBpp0291397; FBgn0051158 [E1JIT7-4]
FBtr0334559; FBpp0306626; FBgn0051158 [E1JIT7-1]
FBtr0334560; FBpp0306627; FBgn0051158 [E1JIT7-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
42665

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dme:Dmel_CG31158

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AE014297 Genomic DNA Translation: AAF56027.4
AE014297 Genomic DNA Translation: AAO41590.3
AE014297 Genomic DNA Translation: ABW08731.1
AE014297 Genomic DNA Translation: ABW08732.1
AE014297 Genomic DNA Translation: ACZ94987.2
AY119244 mRNA Translation: AAM51104.1
BT031108 mRNA Translation: ABX00730.1
BT072828 mRNA Translation: ACN62431.1
RefSeqiNP_001097873.1, NM_001104403.2 [E1JIT7-2]
NP_001097874.1, NM_001104404.2 [E1JIT7-3]
NP_001163691.2, NM_001170220.2 [E1JIT7-1]
NP_732769.3, NM_170027.4 [E1JIT7-4]
NP_788718.3, NM_176541.3 [E1JIT7-5]

3D structure databases

SMRiE1JIT7
ModBaseiSearch...

Proteomic databases

PaxDbiA8JR81
PRIDEiE1JIT7

Genome annotation databases

EnsemblMetazoaiFBtr0113395; FBpp0112307; FBgn0051158 [E1JIT7-2]
FBtr0113396; FBpp0112308; FBgn0051158 [E1JIT7-3]
FBtr0302187; FBpp0291397; FBgn0051158 [E1JIT7-4]
FBtr0334559; FBpp0306626; FBgn0051158 [E1JIT7-1]
FBtr0334560; FBpp0306627; FBgn0051158 [E1JIT7-5]
GeneIDi42665
KEGGidme:Dmel_CG31158

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
42665
FlyBaseiFBgn0051158, Efa6

Phylogenomic databases

eggNOGiKOG0932, Eukaryota
GeneTreeiENSGT00940000155061
HOGENOMiCLU_005163_1_0_1
InParanoidiA8JR81
OMAiMNRKMSC
OrthoDBi274195at2759

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
42665, 0 hits in 3 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Efa6, fly

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
42665

Protein Ontology

More...
PROi
PR:E1JIT7

Gene expression databases

BgeeiFBgn0051158, Expressed in cleaving embryo and 35 other tissues
ExpressionAtlasiE1JIT7, baseline and differential

Family and domain databases

CDDicd00171, Sec7, 1 hit
Gene3Di1.10.1000.11, 1 hit
2.30.29.30, 1 hit
2.30.42.10, 1 hit
InterProiView protein in InterPro
IPR001478, PDZ
IPR041489, PDZ_6
IPR036034, PDZ_sf
IPR011993, PH-like_dom_sf
IPR041681, PH_9
IPR001605, PH_dom-spectrin-type
IPR001849, PH_domain
IPR023394, Sec7_C_sf
IPR000904, Sec7_dom
IPR035999, Sec7_dom_sf
PfamiView protein in Pfam
PF17820, PDZ_6, 1 hit
PF15410, PH_9, 1 hit
PF01369, Sec7, 1 hit
PRINTSiPR00683, SPECTRINPH
SMARTiView protein in SMART
SM00228, PDZ, 1 hit
SM00233, PH, 1 hit
SM00222, Sec7, 1 hit
SUPFAMiSSF48425, SSF48425, 1 hit
SSF50156, SSF50156, 1 hit
PROSITEiView protein in PROSITE
PS50106, PDZ, 1 hit
PS50003, PH_DOMAIN, 1 hit
PS50190, SEC7, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPSD_DROME
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: E1JIT7
Secondary accession number(s): A8JR81
, A8JR82, A8WHG2, C0PUX2, E2QD55, E2QD56, Q8MRV5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 26, 2020
Last sequence update: April 1, 2015
Last modified: June 2, 2021
This is version 102 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again