Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 84 (11 Dec 2019)
Sequence version 2 (01 Apr 2015)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Aldo-keto reductase family 1 member B15

Gene

AKR1B15

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes the NADPH-dependent reduction of a variety of carbonyl substrates, like aromatic aldehydes, alkenals, ketones and alpha-dicarbonyl compounds (PubMed:26222439, PubMed:21276782). In addition, catalyzes the reduction of androgens and estrogens with high positional selectivity (shows 17-beta-hydroxysteroid dehydrogenase activity) as well as 3-keto-acyl-CoAs (PubMed:25577493). Displays strong enzymatic activity toward all-trans-retinal and 9-cis-retinal (PubMed:26222439). May play a physiological role in retinoid metabolism (PubMed:26222439).3 Publications
No oxidoreductase activity observed with the tested substrates.1 Publication

Miscellaneous

Has no counterpart in murine species.Curated

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Inhibited by the inhibitor JF0064.1 Publication

<p>This subsection of the ‘Function’ section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

kcat is 1.7 min(-1) using isoform 1 for the reduction of androsterone. kcat is 1.1 min(-1) using isoform 1 for the reduction of delta-4-androstenedione. kcat is 1.0 min(-1) using isoform 1 for the reduction of estrone. kcat is 0.5 min(-1) using isoform 1 for the reduction of acetoacetyl-CoA. kcat is 3.0 min(-1) using isoform 1 for the oxidation of 3-alpha,17-beta-androstandiol. kcat is 0.6 min(-1) using isoform 1 for the oxidation of testosterone. kcat is 0.5 min(-1) using isoform 1 for the oxidation of 17-beta-estradiol (PubMed:25577493). kcat is 10.7 min(-1) with D,L-glyceraldehyde as substrate. kcat is 9 min(-1) with pyridine-3-aldehyde as substrate. kcat is 7.3 min(-1) with hexanal as substrate. kcat is 9 min(-1) with acrolein as substrate. kcat is 11.3 min(-1) with trans-2-hexenal as substrate. kcat is 5.2 min(-1) with 4-hydroxy-2-nonenal as substrate. kcat is 4.8 min(-1) with farnesal as substrate. kcat is 1.7 min(-1) with 2,3-butanedione as substrate. kcat is 5.4 min(-1) with all-trans-retinaldehyde as substrate. kcat is 3.8 min(-1) with 9-cis-retinal as substrate (PubMed:26222439).2 Publications
  1. KM=2.8 µM for androsterone (tested with isoform 1 in the reductive reaction)1 Publication
  2. KM=1.9 µM for delta-4-androstenedione (tested with isoform 1 in the reductive reaction)1 Publication
  3. KM=2.5 µM for estrone (tested with isoform 1 in the reductive reaction)1 Publication
  4. KM=63.4 µM for acetoacetyl-CoA (tested with isoform 1 in the reductive reaction)1 Publication
  5. KM=19.2 µM for 3-alpha,17-beta-androstandiol (tested with isoform 1 in the oxidative reaction)1 Publication
  6. KM=7.1 µM for testosterone (tested with isoform 1 in the oxidative reaction)1 Publication
  7. KM=9.1 µM for 17-beta-estradiol (tested with isoform 1 in the oxidative reaction)1 Publication
  8. KM=1 µM for all-trans-retinal1 Publication
  9. KM=0.16 µM for 9-cis-retinal1 Publication
  10. KM=880 µM for D,L-glyceraldehyde1 Publication
  11. KM=2.9 µM for pyridine-3-aldehyde1 Publication
  12. KM=3.1 µM for hexanal1 Publication
  13. KM=36 µM for acrolein1 Publication
  14. KM=5 µM for trans-2-hexenal1 Publication
  15. KM=2.2 µM for 4-hydroxy-2-nonenal1 Publication
  16. KM=1.7 µM for 3-nonen-2-one1 Publication
  17. KM=1 µM for 2,3-butanedione1 Publication
  18. KM=1 µM for farnesal1 Publication
  19. KM=5.7 µM for NADPH1 Publication

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei44NADPBy similarity1
    <p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei49Proton donorBy similarity1
    <p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei78Lowers pKa of active site TyrBy similarity1
    Binding sitei111SubstrateBy similarity1
    Binding sitei184NADPBy similarity1

    Regions

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi20 – 22NADPBy similarity3
    Nucleotide bindingi160 – 161NADPBy similarity2
    Nucleotide bindingi210 – 217NADPBy similarity8
    Nucleotide bindingi261 – 273NADPBy similarityAdd BLAST13

    <p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

    GO - Biological processi

    <p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

    Molecular functionOxidoreductase
    LigandNADP

    Enzyme and pathway databases

    Reactome - a knowledgebase of biological pathways and processes

    More...
    Reactomei
    R-HSA-193144 Estrogen biosynthesis

    Chemistry databases

    SwissLipids knowledge resource for lipid biology

    More...
    SwissLipidsi
    SLP:000001307 [C9JRZ8-1]

    <p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
    Recommended name:
    Aldo-keto reductase family 1 member B15Curated (EC:1.1.1.-1 Publication, EC:1.1.1.3001 Publication, EC:1.1.1.541 Publication)
    Alternative name(s):
    Estradiol 17-beta-dehydrogenase AKR1B15Curated
    Farnesol dehydrogenase1 Publication (EC:1.1.1.2161 Publication)
    Testosterone 17beta-dehydrogenase1 Publication (EC:1.1.1.641 Publication)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
    Name:AKR1B15Imported
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
    • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

    Organism-specific databases

    Eukaryotic Pathogen Database Resources

    More...
    EuPathDBi
    HostDB:ENSG00000227471.8

    Human Gene Nomenclature Database

    More...
    HGNCi
    HGNC:37281 AKR1B15

    Online Mendelian Inheritance in Man (OMIM)

    More...
    MIMi
    616336 gene

    neXtProt; the human protein knowledge platform

    More...
    neXtProti
    NX_C9JRZ8

    <p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

    Keywords - Cellular componenti

    Cytoplasm, Mitochondrion

    <p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

    Organism-specific databases

    Open Targets

    More...
    OpenTargetsi
    ENSG00000227471

    The Pharmacogenetics and Pharmacogenomics Knowledge Base

    More...
    PharmGKBi
    PA165617622

    Miscellaneous databases

    Pharos NIH Druggable Genome Knowledgebase

    More...
    Pharosi
    C9JRZ8 Tbio

    Polymorphism and mutation databases

    BioMuta curated single-nucleotide variation and disease association database

    More...
    BioMutai
    AKR1B15

    <p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003953411 – 316Aldo-keto reductase family 1 member B15Add BLAST316

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei125N6-acetyllysineBy similarity1
    Modified residuei263N6-acetyllysineBy similarity1

    Keywords - PTMi

    Acetylation

    Proteomic databases

    Encyclopedia of Proteome Dynamics

    More...
    EPDi
    C9JRZ8

    jPOST - Japan Proteome Standard Repository/Database

    More...
    jPOSTi
    C9JRZ8

    MassIVE - Mass Spectrometry Interactive Virtual Environment

    More...
    MassIVEi
    C9JRZ8

    MaxQB - The MaxQuant DataBase

    More...
    MaxQBi
    C9JRZ8

    PaxDb, a database of protein abundance averages across all three domains of life

    More...
    PaxDbi
    C9JRZ8

    PRoteomics IDEntifications database

    More...
    PRIDEi
    C9JRZ8

    ProteomicsDB: a multi-organism proteome resource

    More...
    ProteomicsDBi
    11424 [C9JRZ8-1]
    11425 [C9JRZ8-2]

    PTM databases

    iPTMnet integrated resource for PTMs in systems biology context

    More...
    iPTMneti
    C9JRZ8

    Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

    More...
    PhosphoSitePlusi
    C9JRZ8

    <p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

    <p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

    Widely expressed. Expressed at highest levels in steroid-sensitive tissues, such as placenta, testis and adipose tissue.1 Publication

    Gene expression databases

    Bgee dataBase for Gene Expression Evolution

    More...
    Bgeei
    ENSG00000227471 Expressed in 60 organ(s), highest expression level in gastrocnemius

    Organism-specific databases

    Human Protein Atlas

    More...
    HPAi
    HPA020280
    HPA073633

    <p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

    <p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

    Monomer.

    1 Publication

    Protein-protein interaction databases

    The Biological General Repository for Interaction Datasets (BioGrid)

    More...
    BioGridi
    137330, 11 interactors

    Protein interaction database and analysis system

    More...
    IntActi
    C9JRZ8, 3 interactors

    STRING: functional protein association networks

    More...
    STRINGi
    9606.ENSP00000389289

    Miscellaneous databases

    RNAct, Protein-RNA interaction predictions for model organisms.

    More...
    RNActi
    C9JRZ8 protein

    <p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

    3D structure databases

    SWISS-MODEL Repository - a database of annotated 3D protein structure models

    More...
    SMRi
    C9JRZ8

    Database of comparative protein structure models

    More...
    ModBasei
    Search...

    <p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

    <p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

    Belongs to the aldo/keto reductase family.Curated

    Phylogenomic databases

    evolutionary genealogy of genes: Non-supervised Orthologous Groups

    More...
    eggNOGi
    KOG1577 Eukaryota
    COG0656 LUCA

    Ensembl GeneTree

    More...
    GeneTreei
    ENSGT00940000164182

    The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

    More...
    HOGENOMi
    HOG000250272

    InParanoid: Eukaryotic Ortholog Groups

    More...
    InParanoidi
    C9JRZ8

    Identification of Orthologs from Complete Genome Data

    More...
    OMAi
    TSKLWLQ

    Database of Orthologous Groups

    More...
    OrthoDBi
    1016440at2759

    TreeFam database of animal gene trees

    More...
    TreeFami
    TF106492

    Family and domain databases

    Conserved Domains Database

    More...
    CDDi
    cd06660 Aldo_ket_red, 1 hit

    Gene3D Structural and Functional Annotation of Protein Families

    More...
    Gene3Di
    3.20.20.100, 1 hit

    Integrated resource of protein families, domains and functional sites

    More...
    InterProi
    View protein in InterPro
    IPR018170 Aldo/ket_reductase_CS
    IPR020471 Aldo/keto_reductase
    IPR023210 NADP_OxRdtase_dom
    IPR036812 NADP_OxRdtase_dom_sf

    The PANTHER Classification System

    More...
    PANTHERi
    PTHR11732 PTHR11732, 1 hit

    Pfam protein domain database

    More...
    Pfami
    View protein in Pfam
    PF00248 Aldo_ket_red, 1 hit

    PIRSF; a whole-protein classification database

    More...
    PIRSFi
    PIRSF000097 AKR, 1 hit

    Protein Motif fingerprint database; a protein domain database

    More...
    PRINTSi
    PR00069 ALDKETRDTASE

    Superfamily database of structural and functional annotation

    More...
    SUPFAMi
    SSF51430 SSF51430, 1 hit

    PROSITE; a protein domain and family database

    More...
    PROSITEi
    View protein in PROSITE
    PS00062 ALDOKETO_REDUCTASE_2, 1 hit

    <p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

    This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
    Isoform 1 (identifier: C9JRZ8-1) [UniParc]FASTAAdd to basket
    Also known as: AKR1B15.11 Publication

    This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MATFVELSTK AKMPIVGLGT WRSLLGKVKE AVKVAIDAEY RHIDCAYFYE
    60 70 80 90 100
    NQHEVGEAIQ EKIQEKAVMR EDLFIVSKVW PTFFERPLVR KAFEKTLKDL
    110 120 130 140 150
    KLSYLDVYLI HWPQGFKTGD DFFPKDDKGN MISGKGTFLD AWEAMEELVD
    160 170 180 190 200
    EGLVKALGVS NFNHFQIERL LNKPGLKYKP VTNQVECHPY LTQEKLIQYC
    210 220 230 240 250
    HSKGITVTAY SPLGSPDRPW AKPEDPSLLE DPKIKEIAAK HKKTTAQVLI
    260 270 280 290 300
    RFHIQRNVTV IPKSMTPAHI VENIQVFDFK LSDEEMATIL SFNRNWRAFD
    310
    FKEFSHLEDF PFDAEY
    Length:316
    Mass (Da):36,537
    Last modified:April 1, 2015 - v2
    <p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5FB6CBFA7190C740
    GO
    Isoform 2 (identifier: C9JRZ8-2) [UniParc]FASTAAdd to basket
    Also known as: AKR1B15.21 Publication

    The sequence of this isoform differs from the canonical sequence as follows:
         1-22: MATFVELSTKAKMPIVGLGTWR → MVLQMEPQVNSTNNFHQGPLDQPVGPLTGLKSSLLKDTTSAGPLLRPYPA

    Show »
    Length:344
    Mass (Da):39,460
    Checksum:iA130BB8231C4C946
    GO

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0416061 – 22MATFV…LGTWR → MVLQMEPQVNSTNNFHQGPL DQPVGPLTGLKSSLLKDTTS AGPLLRPYPA in isoform 2. 2 PublicationsAdd BLAST22

    Sequence databases

    Select the link destinations:

    EMBL nucleotide sequence database

    More...
    EMBLi

    GenBank nucleotide sequence database

    More...
    GenBanki

    DNA Data Bank of Japan; a nucleotide sequence database

    More...
    DDBJi
    Links Updated
    AC078847 Genomic DNA No translation available.
    CH471070 Genomic DNA Translation: EAW83819.1

    The Consensus CDS (CCDS) project

    More...
    CCDSi
    CCDS47715.2 [C9JRZ8-2]

    NCBI Reference Sequences

    More...
    RefSeqi
    NP_001074007.2, NM_001080538.2 [C9JRZ8-2]
    XP_011514543.2, XM_011516241.2
    XP_016867713.1, XM_017012224.1 [C9JRZ8-2]

    Genome annotation databases

    Ensembl eukaryotic genome annotation project

    More...
    Ensembli
    ENST00000423958; ENSP00000397009; ENSG00000227471 [C9JRZ8-2]
    ENST00000457545; ENSP00000389289; ENSG00000227471 [C9JRZ8-2]
    ENST00000652743; ENSP00000498877; ENSG00000227471 [C9JRZ8-1]

    Database of genes from NCBI RefSeq genomes

    More...
    GeneIDi
    441282

    KEGG: Kyoto Encyclopedia of Genes and Genomes

    More...
    KEGGi
    hsa:441282

    UCSC genome browser

    More...
    UCSCi
    uc011kpr.3 human [C9JRZ8-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    <p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

    <p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    AC078847 Genomic DNA No translation available.
    CH471070 Genomic DNA Translation: EAW83819.1
    CCDSiCCDS47715.2 [C9JRZ8-2]
    RefSeqiNP_001074007.2, NM_001080538.2 [C9JRZ8-2]
    XP_011514543.2, XM_011516241.2
    XP_016867713.1, XM_017012224.1 [C9JRZ8-2]

    3D structure databases

    SMRiC9JRZ8
    ModBaseiSearch...

    Protein-protein interaction databases

    BioGridi137330, 11 interactors
    IntActiC9JRZ8, 3 interactors
    STRINGi9606.ENSP00000389289

    Chemistry databases

    SwissLipidsiSLP:000001307 [C9JRZ8-1]

    PTM databases

    iPTMnetiC9JRZ8
    PhosphoSitePlusiC9JRZ8

    Polymorphism and mutation databases

    BioMutaiAKR1B15

    Proteomic databases

    EPDiC9JRZ8
    jPOSTiC9JRZ8
    MassIVEiC9JRZ8
    MaxQBiC9JRZ8
    PaxDbiC9JRZ8
    PRIDEiC9JRZ8
    ProteomicsDBi11424 [C9JRZ8-1]
    11425 [C9JRZ8-2]

    Genome annotation databases

    EnsembliENST00000423958; ENSP00000397009; ENSG00000227471 [C9JRZ8-2]
    ENST00000457545; ENSP00000389289; ENSG00000227471 [C9JRZ8-2]
    ENST00000652743; ENSP00000498877; ENSG00000227471 [C9JRZ8-1]
    GeneIDi441282
    KEGGihsa:441282
    UCSCiuc011kpr.3 human [C9JRZ8-1]

    Organism-specific databases

    Comparative Toxicogenomics Database

    More...
    CTDi
    441282
    EuPathDBiHostDB:ENSG00000227471.8

    GeneCards: human genes, protein and diseases

    More...
    GeneCardsi
    AKR1B15
    HGNCiHGNC:37281 AKR1B15
    HPAiHPA020280
    HPA073633
    MIMi616336 gene
    neXtProtiNX_C9JRZ8
    OpenTargetsiENSG00000227471
    PharmGKBiPA165617622

    GenAtlas: human gene database

    More...
    GenAtlasi
    Search...

    Phylogenomic databases

    eggNOGiKOG1577 Eukaryota
    COG0656 LUCA
    GeneTreeiENSGT00940000164182
    HOGENOMiHOG000250272
    InParanoidiC9JRZ8
    OMAiTSKLWLQ
    OrthoDBi1016440at2759
    TreeFamiTF106492

    Enzyme and pathway databases

    ReactomeiR-HSA-193144 Estrogen biosynthesis

    Miscellaneous databases

    Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

    More...
    GenomeRNAii
    441282
    PharosiC9JRZ8 Tbio

    Protein Ontology

    More...
    PROi
    PR:C9JRZ8
    RNActiC9JRZ8 protein

    The Stanford Online Universal Resource for Clones and ESTs

    More...
    SOURCEi
    Search...

    Gene expression databases

    BgeeiENSG00000227471 Expressed in 60 organ(s), highest expression level in gastrocnemius

    Family and domain databases

    CDDicd06660 Aldo_ket_red, 1 hit
    Gene3Di3.20.20.100, 1 hit
    InterProiView protein in InterPro
    IPR018170 Aldo/ket_reductase_CS
    IPR020471 Aldo/keto_reductase
    IPR023210 NADP_OxRdtase_dom
    IPR036812 NADP_OxRdtase_dom_sf
    PANTHERiPTHR11732 PTHR11732, 1 hit
    PfamiView protein in Pfam
    PF00248 Aldo_ket_red, 1 hit
    PIRSFiPIRSF000097 AKR, 1 hit
    PRINTSiPR00069 ALDKETRDTASE
    SUPFAMiSSF51430 SSF51430, 1 hit
    PROSITEiView protein in PROSITE
    PS00062 ALDOKETO_REDUCTASE_2, 1 hit

    ProtoNet; Automatic hierarchical classification of proteins

    More...
    ProtoNeti
    Search...

    MobiDB: a database of protein disorder and mobility annotations

    More...
    MobiDBi
    Search...

    <p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

    <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiAK1BF_HUMAN
    <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: C9JRZ8
    Secondary accession number(s): C9J3V2
    <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 13, 2010
    Last sequence update: April 1, 2015
    Last modified: December 11, 2019
    This is version 84 of the entry and version 2 of the sequence. See complete history.
    <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    <p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

    Keywords - Technical termi

    Reference proteome

    Documents

    1. SIMILARITY comments
      Index of protein domains and families
    2. Human chromosome 7
      Human chromosome 7: entries, gene names and cross-references to MIM
    3. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again