Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 94 (29 Sep 2021)
Sequence version 2 (01 Apr 2015)
Previous versions | rss
Add a publicationFeedback
Protein

Aldo-keto reductase family 1 member B15

Gene

AKR1B15

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes the NADPH-dependent reduction of a variety of carbonyl substrates, like aromatic aldehydes, alkenals, ketones and alpha-dicarbonyl compounds (PubMed:26222439, PubMed:21276782).

In addition, catalyzes the reduction of androgens and estrogens with high positional selectivity (shows 17-beta-hydroxysteroid dehydrogenase activity) as well as 3-keto-acyl-CoAs (PubMed:25577493).

Displays strong enzymatic activity toward all-trans-retinal and 9-cis-retinal (PubMed:26222439).

May play a physiological role in retinoid metabolism (PubMed:26222439).

3 Publications

No oxidoreductase activity observed with the tested substrates.

1 Publication

Miscellaneous

Has no counterpart in murine species.Curated

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Inhibited by the inhibitor JF0064.1 Publication

<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

kcat is 1.7 min(-1) using isoform 1 for the reduction of androsterone. kcat is 1.1 min(-1) using isoform 1 for the reduction of delta-4-androstenedione. kcat is 1.0 min(-1) using isoform 1 for the reduction of estrone. kcat is 0.5 min(-1) using isoform 1 for the reduction of acetoacetyl-CoA. kcat is 3.0 min(-1) using isoform 1 for the oxidation of 3-alpha,17-beta-androstandiol. kcat is 0.6 min(-1) using isoform 1 for the oxidation of testosterone. kcat is 0.5 min(-1) using isoform 1 for the oxidation of 17-beta-estradiol (PubMed:25577493). kcat is 10.7 min(-1) with D,L-glyceraldehyde as substrate. kcat is 9 min(-1) with pyridine-3-aldehyde as substrate. kcat is 7.3 min(-1) with hexanal as substrate. kcat is 9 min(-1) with acrolein as substrate. kcat is 11.3 min(-1) with trans-2-hexenal as substrate. kcat is 5.2 min(-1) with 4-hydroxy-2-nonenal as substrate. kcat is 4.8 min(-1) with farnesal as substrate. kcat is 1.7 min(-1) with 2,3-butanedione as substrate. kcat is 5.4 min(-1) with all-trans-retinaldehyde as substrate. kcat is 3.8 min(-1) with 9-cis-retinal as substrate (PubMed:26222439).2 Publications
  1. KM=2.8 µM for androsterone (tested with isoform 1 in the reductive reaction)1 Publication
  2. KM=1.9 µM for delta-4-androstenedione (tested with isoform 1 in the reductive reaction)1 Publication
  3. KM=2.5 µM for estrone (tested with isoform 1 in the reductive reaction)1 Publication
  4. KM=63.4 µM for acetoacetyl-CoA (tested with isoform 1 in the reductive reaction)1 Publication
  5. KM=19.2 µM for 3-alpha,17-beta-androstandiol (tested with isoform 1 in the oxidative reaction)1 Publication
  6. KM=7.1 µM for testosterone (tested with isoform 1 in the oxidative reaction)1 Publication
  7. KM=9.1 µM for 17-beta-estradiol (tested with isoform 1 in the oxidative reaction)1 Publication
  8. KM=1 µM for all-trans-retinal1 Publication
  9. KM=0.16 µM for 9-cis-retinal1 Publication
  10. KM=880 µM for D,L-glyceraldehyde1 Publication
  11. KM=2.9 µM for pyridine-3-aldehyde1 Publication
  12. KM=3.1 µM for hexanal1 Publication
  13. KM=36 µM for acrolein1 Publication
  14. KM=5 µM for trans-2-hexenal1 Publication
  15. KM=2.2 µM for 4-hydroxy-2-nonenal1 Publication
  16. KM=1.7 µM for 3-nonen-2-one1 Publication
  17. KM=1 µM for 2,3-butanedione1 Publication
  18. KM=1 µM for farnesal1 Publication
  19. KM=5.7 µM for NADPH1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei44NADPBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei49Proton donorBy similarity1
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei78Lowers pKa of active site TyrBy similarity1
Binding sitei111SubstrateBy similarity1
Binding sitei184NADPBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi20 – 22NADPBy similarity3
Nucleotide bindingi160 – 161NADPBy similarity2
Nucleotide bindingi210 – 217NADPBy similarity8
Nucleotide bindingi261 – 273NADPBy similarityAdd BLAST13

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionOxidoreductase
Biological processLipid metabolism
LigandNADP

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
1.1.1.36, 2681
1.1.1.62, 2681

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
C9JRZ8

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-193144, Estrogen biosynthesis

Chemistry databases

SwissLipids knowledge resource for lipid biology

More...
SwissLipidsi
SLP:000001307 [C9JRZ8-1]

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Aldo-keto reductase family 1 member B15Curated (EC:1.1.1.-1 Publication, EC:1.1.1.3001 Publication, EC:1.1.1.541 Publication)
Alternative name(s):
Estradiol 17-beta-dehydrogenase AKR1B15Curated
Farnesol dehydrogenase1 Publication (EC:1.1.1.2161 Publication)
Testosterone 17beta-dehydrogenase1 Publication (EC:1.1.1.641 Publication)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:AKR1B15Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:37281, AKR1B15

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
616336, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_C9JRZ8

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000227471

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm, Mitochondrion

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
441282

Open Targets

More...
OpenTargetsi
ENSG00000227471

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA165617622

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
C9JRZ8, Tbio

Chemistry databases

Drug and drug target database

More...
DrugBanki
DB06077, Lumateperone

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
AKR1B15

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003953411 – 316Aldo-keto reductase family 1 member B15Add BLAST316

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei125N6-acetyllysineBy similarity1
Modified residuei263N6-acetyllysineBy similarity1

Keywords - PTMi

Acetylation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
C9JRZ8

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
C9JRZ8

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
C9JRZ8

MaxQB - The MaxQuant DataBase

More...
MaxQBi
C9JRZ8

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
C9JRZ8

PeptideAtlas

More...
PeptideAtlasi
C9JRZ8

PRoteomics IDEntifications database

More...
PRIDEi
C9JRZ8

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
11424 [C9JRZ8-1]
11425 [C9JRZ8-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
C9JRZ8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
C9JRZ8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed. Expressed at highest levels in steroid-sensitive tissues, such as placenta, testis and adipose tissue.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000227471, Expressed in stomach and 80 other tissues

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000227471, Tissue enhanced (breast, placenta)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
137330, 12 interactors

Protein interaction database and analysis system

More...
IntActi
C9JRZ8, 3 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000389289

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
C9JRZ8, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
C9JRZ8

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the aldo/keto reductase family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1577, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000164182

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_023205_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
C9JRZ8

Identification of Orthologs from Complete Genome Data

More...
OMAi
FGTWTLG

Database of Orthologous Groups

More...
OrthoDBi
1016440at2759

TreeFam database of animal gene trees

More...
TreeFami
TF106492

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.20.20.100, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR020471, AKR
IPR018170, Aldo/ket_reductase_CS
IPR023210, NADP_OxRdtase_dom
IPR036812, NADP_OxRdtase_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00248, Aldo_ket_red, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF000097, AKR, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00069, ALDKETRDTASE

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF51430, SSF51430, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00062, ALDOKETO_REDUCTASE_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: C9JRZ8-1) [UniParc]FASTAAdd to basket
Also known as: AKR1B15.11 Publication

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MATFVELSTK AKMPIVGLGT WRSLLGKVKE AVKVAIDAEY RHIDCAYFYE
60 70 80 90 100
NQHEVGEAIQ EKIQEKAVMR EDLFIVSKVW PTFFERPLVR KAFEKTLKDL
110 120 130 140 150
KLSYLDVYLI HWPQGFKTGD DFFPKDDKGN MISGKGTFLD AWEAMEELVD
160 170 180 190 200
EGLVKALGVS NFNHFQIERL LNKPGLKYKP VTNQVECHPY LTQEKLIQYC
210 220 230 240 250
HSKGITVTAY SPLGSPDRPW AKPEDPSLLE DPKIKEIAAK HKKTTAQVLI
260 270 280 290 300
RFHIQRNVTV IPKSMTPAHI VENIQVFDFK LSDEEMATIL SFNRNWRAFD
310
FKEFSHLEDF PFDAEY
Length:316
Mass (Da):36,537
Last modified:April 1, 2015 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5FB6CBFA7190C740
GO
Isoform 2 (identifier: C9JRZ8-2) [UniParc]FASTAAdd to basket
Also known as: AKR1B15.21 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-22: MATFVELSTKAKMPIVGLGTWR → MVLQMEPQVNSTNNFHQGPLDQPVGPLTGLKSSLLKDTTSAGPLLRPYPA

Show »
Length:344
Mass (Da):39,460
Checksum:iA130BB8231C4C946
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0416061 – 22MATFV…LGTWR → MVLQMEPQVNSTNNFHQGPL DQPVGPLTGLKSSLLKDTTS AGPLLRPYPA in isoform 2. 2 PublicationsAdd BLAST22

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AC078847 Genomic DNA No translation available.
CH471070 Genomic DNA Translation: EAW83819.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS47715.2 [C9JRZ8-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001074007.2, NM_001080538.2 [C9JRZ8-2]
XP_011514543.2, XM_011516241.2
XP_016867713.1, XM_017012224.1 [C9JRZ8-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000423958; ENSP00000397009; ENSG00000227471 [C9JRZ8-2]
ENST00000457545; ENSP00000389289; ENSG00000227471 [C9JRZ8-2]
ENST00000652743; ENSP00000498877; ENSG00000227471 [C9JRZ8-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
441282

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:441282

UCSC genome browser

More...
UCSCi
uc011kpr.3, human [C9JRZ8-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC078847 Genomic DNA No translation available.
CH471070 Genomic DNA Translation: EAW83819.1
CCDSiCCDS47715.2 [C9JRZ8-2]
RefSeqiNP_001074007.2, NM_001080538.2 [C9JRZ8-2]
XP_011514543.2, XM_011516241.2
XP_016867713.1, XM_017012224.1 [C9JRZ8-2]

3D structure databases

SMRiC9JRZ8
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi137330, 12 interactors
IntActiC9JRZ8, 3 interactors
STRINGi9606.ENSP00000389289

Chemistry databases

DrugBankiDB06077, Lumateperone
SwissLipidsiSLP:000001307 [C9JRZ8-1]

PTM databases

iPTMnetiC9JRZ8
PhosphoSitePlusiC9JRZ8

Genetic variation databases

BioMutaiAKR1B15

Proteomic databases

EPDiC9JRZ8
jPOSTiC9JRZ8
MassIVEiC9JRZ8
MaxQBiC9JRZ8
PaxDbiC9JRZ8
PeptideAtlasiC9JRZ8
PRIDEiC9JRZ8
ProteomicsDBi11424 [C9JRZ8-1]
11425 [C9JRZ8-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
67875, 6 antibodies

The DNASU plasmid repository

More...
DNASUi
441282

Genome annotation databases

EnsembliENST00000423958; ENSP00000397009; ENSG00000227471 [C9JRZ8-2]
ENST00000457545; ENSP00000389289; ENSG00000227471 [C9JRZ8-2]
ENST00000652743; ENSP00000498877; ENSG00000227471 [C9JRZ8-1]
GeneIDi441282
KEGGihsa:441282
UCSCiuc011kpr.3, human [C9JRZ8-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
441282
DisGeNETi441282

GeneCards: human genes, protein and diseases

More...
GeneCardsi
AKR1B15
HGNCiHGNC:37281, AKR1B15
HPAiENSG00000227471, Tissue enhanced (breast, placenta)
MIMi616336, gene
neXtProtiNX_C9JRZ8
OpenTargetsiENSG00000227471
PharmGKBiPA165617622
VEuPathDBiHostDB:ENSG00000227471

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1577, Eukaryota
GeneTreeiENSGT00940000164182
HOGENOMiCLU_023205_0_0_1
InParanoidiC9JRZ8
OMAiFGTWTLG
OrthoDBi1016440at2759
TreeFamiTF106492

Enzyme and pathway databases

BRENDAi1.1.1.36, 2681
1.1.1.62, 2681
PathwayCommonsiC9JRZ8
ReactomeiR-HSA-193144, Estrogen biosynthesis

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
441282, 208 hits in 939 CRISPR screens

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
441282
PharosiC9JRZ8, Tbio

Protein Ontology

More...
PROi
PR:C9JRZ8
RNActiC9JRZ8, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000227471, Expressed in stomach and 80 other tissues

Family and domain databases

Gene3Di3.20.20.100, 1 hit
InterProiView protein in InterPro
IPR020471, AKR
IPR018170, Aldo/ket_reductase_CS
IPR023210, NADP_OxRdtase_dom
IPR036812, NADP_OxRdtase_dom_sf
PfamiView protein in Pfam
PF00248, Aldo_ket_red, 1 hit
PIRSFiPIRSF000097, AKR, 1 hit
PRINTSiPR00069, ALDKETRDTASE
SUPFAMiSSF51430, SSF51430, 1 hit
PROSITEiView protein in PROSITE
PS00062, ALDOKETO_REDUCTASE_2, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiAK1BF_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: C9JRZ8
Secondary accession number(s): C9J3V2
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 13, 2010
Last sequence update: April 1, 2015
Last modified: September 29, 2021
This is version 94 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again