Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 86 (17 Jun 2020)
Sequence version 2 (01 May 2013)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Cortactin-binding protein 2

Gene

Cttnbp2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regulates the dendritic spine distribution of CTTN/cortactin in hippocampal neurons, and thus controls dendritic spinogenesis and dendritic spine maintenance.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cortactin-binding protein 2
Short name:
CortBP2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Cttnbp2
Synonyms:Kiaa1758
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1353467 Cttnbp2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell junction, Cell projection, Cytoplasm, Synapse

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi540P → A: Almost complete loss of CTTN-binding and loss of regulation of spine density; when associated with A-543. 1 Publication1
Mutagenesisi543P → A: Almost complete loss of CTTN-binding and loss of regulation of spine density; when associated with A-540. 1 Publication1
Mutagenesisi599P → A: Reduced CTTN-binding; when associated with A-602. 1 Publication1
Mutagenesisi602P → A: Reduced CTTN-binding; when associated with A-599. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00004221721 – 1648Cortactin-binding protein 2Add BLAST1648

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei495Asymmetric dimethylarginineCombined sources1
Modified residuei1510PhosphoserineCombined sources1

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
B9EJA2

PeptideAtlas

More...
PeptideAtlasi
B9EJA2

PRoteomics IDEntifications database

More...
PRIDEi
B9EJA2

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
B9EJA2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
B9EJA2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 2 is predominantly expressed in brain (at protein level). In the brain, expressed at high levels in hypothalamus and striatum and at lower levels in cerebellum and cortex.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000000416 Expressed in Ammon's horn and 209 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
B9EJA2 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
B9EJA2 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with CTTN/cortactin SH3 domain.

Interacts with STRN, STRN4/zinedin and MOB4/phocein; this interaction may regulate dendritic spine distribution of STRN and STRN4 in hippocampal neurons (By similarity). Activation of glutamate receptors weakens the interaction with STRN and STRN4 (By similarity).

By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
205963, 4 interactors

Protein interaction database and analysis system

More...
IntActi
B9EJA2, 3 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000088089

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
B9EJA2 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
B9EJA2

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati699 – 729ANK 1Add BLAST31
Repeati733 – 762ANK 2Add BLAST30
Repeati766 – 795ANK 3Add BLAST30
Repeati799 – 828ANK 4Add BLAST30
Repeati832 – 861ANK 5Add BLAST30
Repeati901 – 931ANK 6Add BLAST31

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili119 – 274Sequence analysisAdd BLAST156

Keywords - Domaini

ANK repeat, Coiled coil, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IGN3 Eukaryota
COG0666 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158293

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_028813_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
B9EJA2

Identification of Orthologs from Complete Genome Data

More...
OMAi
YERNRQK

Database of Orthologous Groups

More...
OrthoDBi
264951at2759

TreeFam database of animal gene trees

More...
TreeFami
TF325130

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.40.20, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR019131 Cortactin-binding_p2_N

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00023 Ank, 1 hit
PF12796 Ank_2, 1 hit
PF09727 CortBP2, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00248 ANK, 6 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48403 SSF48403, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 4 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: B9EJA2-1) [UniParc]FASTAAdd to basket
Also known as: CTTNBP2-L

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MATDSASCEP DLSRTPGDTE GATAEAAKKE FDVDTLSKSE LRMLLSVMEG
60 70 80 90 100
ELEARDLVIE ALRARRKEVF IQERYGRFNL NDPFLALQRD YEAGPGDKEK
110 120 130 140 150
PVCTNPLSIL EAVMAHCRKM QERMSAQLVA AESRQKKLEM EKLQLQALEQ
160 170 180 190 200
EHKKLAAHLE EERGKNKHVV LMLVKECKQL SGKVVEEAQK LEEVMAQLEE
210 220 230 240 250
EKKKTSELEE QLSAEKQRSS GMEAQLEKQL SEFDTEREQL RAKLSREEAH
260 270 280 290 300
TTDLKEEIDK MKKMMEQMKK GSDGKPGLSL PRKTKDKRLA SISVATEGPV
310 320 330 340 350
TRSVACQTDV VTESTDPVKK LPLTVPIKPS TGSPLVPTNT KGNVGPSALL
360 370 380 390 400
IRPGIDRQSS HSDLGPSPPT ALPSSANRIE ENGPSTGNAP DLSNSTPSTP
410 420 430 440 450
SSTAPAAAQT PGTAPQNHSQ APTVHSLHSP CANTHPGLNP RIQAARFRFQ
460 470 480 490 500
GNANDPDQNG NNTQSPPSRD VSPTSRDNLV AKQLARNTVT QALSRFTSPQ
510 520 530 540 550
AGASSRLGVS PGGDAGTCPP VGRTGLKTPG AARVDRGNPP PIPPKKPGLS
560 570 580 590 600
QTPSPPHPQL RASNAGAKVD NKIVASPPST LPQGTKVVNE ENVPKSSSPQ
610 620 630 640 650
LPPKPSIDLT VAPAGCPVSA LATSQVGAWP AGTPGLNQPA CSDSSLVIPA
660 670 680 690 700
TVAFCSSINP VSASSRSPGA SDSLLVAASG WSPSLTPLLM SGGPAPLAGR
710 720 730 740 750
PTLLQQAAAQ GNVTLLSMLL NEEGLDINYS CEDGHSALYS AAKNGHTDCV
760 770 780 790 800
RLLLNAEARV DAADKNGFTP LCVAAAQGHF ECIELLTAYN ANINHSAAGG
810 820 830 840 850
QTPLYLACKN GNKECIKLLL EAGTDRSIKT RDGWTPIHAA VDTGNVDSLK
860 870 880 890 900
LLMYHRVRAH GNSLSSEEPK SGLFSLNGGE SPTGPSKPVV PADLINHADK
910 920 930 940 950
EGWTAAHIAA SKGFKNCLEV LCRHGGLEPE RRDKCNRTVH DVATDDCKHL
960 970 980 990 1000
LENLNALKIP LRISVGEIQP SNDVSDDFEC EHTICTLNIR KQTSWEDFSK
1010 1020 1030 1040 1050
AVSQALTNHF QAISSDGWWS LEDGTFNNAT DSCIGLGTSS IRSIMLGSMP
1060 1070 1080 1090 1100
WSTGQSFSQS PWDFLKKKKV EQVLALLSGP QEGCLSSVTY ASMIPLQMLQ
1110 1120 1130 1140 1150
NYLRLVEQYH NVIFHGPEGS LQDYIANQLA LCMKYRQMAA GFPCEIVRAE
1160 1170 1180 1190 1200
VDSGFSKEQL VDVFIRNACL IPVKQFPVKK KIIVILENLE KSSLSELLGD
1210 1220 1230 1240 1250
FLAPLENRST ESPCTFQKGN GTSECYYFHE NCFLVGTIAK ACLQGSDLLV
1260 1270 1280 1290 1300
QQHFRWVQLR WDCEPIQGLL QRFLRRKVVS KFRGQLPAPC DPVCKIVDWA
1310 1320 1330 1340 1350
LSVWRQLNSC LARLGTPEAL LGPKYFLSCP VVPGHAQATV KWMSKLWNAV
1360 1370 1380 1390 1400
IAPRVQEAIL SRASMNKQPG TGQTASKKYP SQGQQAVVRA ALSILLNKAV
1410 1420 1430 1440 1450
LHGCPLPRAE LDQQIADFKG GSFPLSIVSS YSKKKVESGA WRKVNTSPRK
1460 1470 1480 1490 1500
KPGHFSSPTW NKPDPKREGM RNKTIPHLNT NRNSSLSKQQ SLENDLSVTL
1510 1520 1530 1540 1550
TLDHRLSLGS DDEADLVKEL QSMCSSKSES DISKIADSRD DLRKFDSSRT
1560 1570 1580 1590 1600
NPGTSAPLNL RTPVPQKEAS PPSSRQTAEC SNSKSKTEMG VSSVKSFLPV
1610 1620 1630 1640
PRSKVAQCSQ NTKRNSSSSN TRQLEINNNS KEENWTLDKH EQVEKPNK
Length:1,648
Mass (Da):178,774
Last modified:May 1, 2013 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7C7016DB9E61D7E0
GO
Isoform 2 (identifier: B9EJA2-2) [UniParc]FASTAAdd to basket
Also known as: CTTNBP2-S

The sequence of this isoform differs from the canonical sequence as follows:
     626-630: VGAWP → AGHPP
     631-1648: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:630
Mass (Da):67,549
Checksum:iDAB904B4C2086805
GO
Isoform 3 (identifier: B9EJA2-3) [UniParc]FASTAAdd to basket
Also known as: CTTNBP2-intron

The sequence of this isoform differs from the canonical sequence as follows:
     681-710: WSPSLTPLLMSGGPAPLAGRPTLLQQAAAQ → KGIEVFYPFVKNVPYSLTSLNFFYVVLKRF
     711-1648: Missing.

Note: Due to intron retention.Curated
Show »
Length:710
Mass (Da):75,900
Checksum:i9418424395611C6B
GO
Isoform 4 (identifier: B9EJA2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1568-1648: EASPPSSRQT...KHEQVEKPNK → KQSRSVFPEH...IGLPTPPTTT

Note: May be due to competing acceptor splice site.Curated
Show »
Length:1,623
Mass (Da):176,483
Checksum:i098F1010FBE909F1
GO
Isoform 5 (identifier: B9EJA2-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     626-680: VGAWPAGTPGLNQPACSDSSLVIPATVAFCSSINPVSASSRSPGASDSLLVAASG → KIQKVKCTREEPSC

Show »
Length:1,607
Mass (Da):175,193
Checksum:iF1CDBDB0188294FB
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F6Q1W8F6Q1W8_MOUSE
Cortactin-binding protein 2
Cttnbp2
1,139Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3Z1E3D3Z1E3_MOUSE
Cortactin-binding protein 2
Cttnbp2
160Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3Z551D3Z551_MOUSE
Cortactin-binding protein 2
Cttnbp2
94Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6XSM7F6XSM7_MOUSE
Cortactin-binding protein 2
Cttnbp2
193Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAD32532 differs from that shown. Erroneous CDS prediction and frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti521V → F in AK028980 (PubMed:16141072).Curated1
Sequence conflicti661V → F in AK028980 (PubMed:16141072).Curated1
Sequence conflicti1619S → SSS in AAI41408 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_046473626 – 680VGAWP…VAASG → KIQKVKCTREEPSC in isoform 5. 1 PublicationAdd BLAST55
Alternative sequenceiVSP_046474626 – 630VGAWP → AGHPP in isoform 2. 1 Publication5
Alternative sequenceiVSP_046475631 – 1648Missing in isoform 2. 1 PublicationAdd BLAST1018
Alternative sequenceiVSP_046476681 – 710WSPSL…QAAAQ → KGIEVFYPFVKNVPYSLTSL NFFYVVLKRF in isoform 3. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_046477711 – 1648Missing in isoform 3. 1 PublicationAdd BLAST938
Alternative sequenceiVSP_0464781568 – 1648EASPP…EKPNK → KQSRSVFPEHQKKQQQQQYK ATRNQQQLQRRELDLRQTRT SRKTKQIGLPTPPTTT in isoform 4. 1 PublicationAdd BLAST81

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK028980 mRNA No translation available.
AK032356 mRNA Translation: BAC27832.1
AK078315 mRNA Translation: BAC37216.1
AC027654 Genomic DNA No translation available.
AC158663 Genomic DNA No translation available.
CH466533 Genomic DNA Translation: EDL13863.1
BC068156 mRNA No translation available.
BQ769661 mRNA No translation available.
BC141407 mRNA Translation: AAI41408.1
CB526439 mRNA No translation available.
AK173254 mRNA Translation: BAD32532.1 Sequence problems.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS39432.1 [B9EJA2-1]

NCBI Reference Sequences

More...
RefSeqi
NP_525024.1, NM_080285.1 [B9EJA2-1]
XP_006505167.1, XM_006505104.2 [B9EJA2-5]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000090601; ENSMUSP00000088089; ENSMUSG00000000416 [B9EJA2-1]
ENSMUST00000148602; ENSMUSP00000118432; ENSMUSG00000000416 [B9EJA2-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
30785

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:30785

UCSC genome browser

More...
UCSCi
uc009bak.1 mouse [B9EJA2-1]
uc009ban.1 mouse [B9EJA2-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK028980 mRNA No translation available.
AK032356 mRNA Translation: BAC27832.1
AK078315 mRNA Translation: BAC37216.1
AC027654 Genomic DNA No translation available.
AC158663 Genomic DNA No translation available.
CH466533 Genomic DNA Translation: EDL13863.1
BC068156 mRNA No translation available.
BQ769661 mRNA No translation available.
BC141407 mRNA Translation: AAI41408.1
CB526439 mRNA No translation available.
AK173254 mRNA Translation: BAD32532.1 Sequence problems.
CCDSiCCDS39432.1 [B9EJA2-1]
RefSeqiNP_525024.1, NM_080285.1 [B9EJA2-1]
XP_006505167.1, XM_006505104.2 [B9EJA2-5]

3D structure databases

SMRiB9EJA2
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi205963, 4 interactors
IntActiB9EJA2, 3 interactors
STRINGi10090.ENSMUSP00000088089

PTM databases

iPTMnetiB9EJA2
PhosphoSitePlusiB9EJA2

Proteomic databases

PaxDbiB9EJA2
PeptideAtlasiB9EJA2
PRIDEiB9EJA2

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
3970 88 antibodies

Genome annotation databases

EnsembliENSMUST00000090601; ENSMUSP00000088089; ENSMUSG00000000416 [B9EJA2-1]
ENSMUST00000148602; ENSMUSP00000118432; ENSMUSG00000000416 [B9EJA2-2]
GeneIDi30785
KEGGimmu:30785
UCSCiuc009bak.1 mouse [B9EJA2-1]
uc009ban.1 mouse [B9EJA2-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
83992
MGIiMGI:1353467 Cttnbp2

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiENOG410IGN3 Eukaryota
COG0666 LUCA
GeneTreeiENSGT00940000158293
HOGENOMiCLU_028813_1_0_1
InParanoidiB9EJA2
OMAiYERNRQK
OrthoDBi264951at2759
TreeFamiTF325130

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
30785 0 hits in 12 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Cttnbp2 mouse

Protein Ontology

More...
PROi
PR:B9EJA2
RNActiB9EJA2 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000000416 Expressed in Ammon's horn and 209 other tissues
ExpressionAtlasiB9EJA2 baseline and differential
GenevisibleiB9EJA2 MM

Family and domain databases

Gene3Di1.25.40.20, 2 hits
InterProiView protein in InterPro
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR019131 Cortactin-binding_p2_N
PfamiView protein in Pfam
PF00023 Ank, 1 hit
PF12796 Ank_2, 1 hit
PF09727 CortBP2, 1 hit
SMARTiView protein in SMART
SM00248 ANK, 6 hits
SUPFAMiSSF48403 SSF48403, 1 hit
PROSITEiView protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 4 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCTTB2_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: B9EJA2
Secondary accession number(s): G3X9L7
, Q69ZB2, Q8BVG1, Q8C044
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 1, 2013
Last sequence update: May 1, 2013
Last modified: June 17, 2020
This is version 86 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again