Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 80 (11 Dec 2019)
Sequence version 1 (03 Mar 2009)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Xaa-Pro aminopeptidase 3

Gene

Xpnpep3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes the removal of a penultimate prolyl residue from the N-termini of peptides, such as Leu-Pro-Ala. Also shows low activity towards peptides with Ala or Ser at the P1 position. Promotes TNFRSF1B-mediated phosphorylation of MAPK8/JNK1 and MAPK9/JNK2, suggesting a function as an adapter protein for TNFRSF1B; the effect is independent of XPNPEP3 peptidase activity. May inhibit apoptotic cell death induced via TNF-TNFRSF1B signaling.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • Release of any N-terminal amino acid, including proline, that is linked to proline, even from a dipeptide or tripeptide.By similarity EC:3.4.11.9

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mn2+By similarityNote: Binds 2 manganese ions per subunit.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei300SubstrateBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi331Manganese 2By similarity1
Binding sitei331SubstrateBy similarity1
Metal bindingi342Manganese 1By similarity1
Metal bindingi342Manganese 2By similarity1
Binding sitei342SubstrateBy similarity1
Metal bindingi423Manganese 1By similarity1
Binding sitei423SubstrateBy similarity1
Binding sitei430SubstrateBy similarity1
Metal bindingi450Manganese 1By similarity1
Binding sitei450SubstrateBy similarity1
Metal bindingi474Manganese 1By similarity1
Metal bindingi474Manganese 2By similarity1
Binding sitei474SubstrateBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase
LigandManganese, Metal-binding

Protein family/group databases

MEROPS protease database

More...
MEROPSi
M24.026

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Xaa-Pro aminopeptidase 3Imported (EC:3.4.11.9)
Short name:
X-Pro aminopeptidase 3
Alternative name(s):
Aminopeptidase P3
Short name:
APP3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Xpnpep3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 15

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2445217 Xpnpep3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Mitochondrion

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a transit peptide.<p><a href='/help/transit' target='_top'>More...</a></p>Transit peptidei1 – 31MitochondrionSequence analysisAdd BLAST31
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000040120832 – 506Xaa-Pro aminopeptidase 3Add BLAST475

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
B7ZMP1

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
B7ZMP1

MaxQB - The MaxQuant DataBase

More...
MaxQBi
B7ZMP1

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
B7ZMP1

PeptideAtlas

More...
PeptideAtlasi
B7ZMP1

PRoteomics IDEntifications database

More...
PRIDEi
B7ZMP1

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
B7ZMP1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
B7ZMP1

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
B7ZMP1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in brain, kidney, heart, liver, skeletal muscle and testis.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000022401 Expressed in 219 organ(s), highest expression level in brown adipose tissue

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
B7ZMP1 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
B7ZMP1 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer.

Interacts with TNFRSF1B/TNFR2 (activated) and TRAF2.

By similarity

GO - Molecular functioni

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
B7ZMP1, 1 interactor

Molecular INTeraction database

More...
MINTi
B7ZMP1

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000038331

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
B7ZMP1 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
B7ZMP1

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni54 – 79Interaction with TNFRSF1BBy similarityAdd BLAST26

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the peptidase M24B family.Curated

Keywords - Domaini

Transit peptide

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2414 Eukaryota
COG0006 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153657

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000008762

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
B7ZMP1

KEGG Orthology (KO)

More...
KOi
K01262

Identification of Orthologs from Complete Genome Data

More...
OMAi
TGFNEPN

Database of Orthologous Groups

More...
OrthoDBi
352329at2759

TreeFam database of animal gene trees

More...
TreeFami
TF314484

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.350.10, 1 hit
3.90.230.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR007865 Aminopep_P_N
IPR029149 Creatin/AminoP/Spt16_NTD
IPR036005 Creatinase/aminopeptidase-like
IPR000994 Pept_M24

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF05195 AMP_N, 1 hit
PF00557 Peptidase_M24, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01011 AMP_N, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF53092 SSF53092, 1 hit
SSF55920 SSF55920, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: B7ZMP1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPSLLSTPKL APVLARLRGL SGCMSCLQRR YSLQPAPVKK IPNRYLGQPS
60 70 80 90 100
PVTHPHLLRP GEVTPGLSQV EYALRRHKLM ALVHKEAQGH SGTDHTVVVL
110 120 130 140 150
SNPTYYMSND IPYTFHQDNN FLYLCGFQEP DSILVLQSFS GKQLPSHKAM
160 170 180 190 200
LFVPRRDPGR ELWDGPRSGT DGAIALTGVD EAYPLEEFQH LLPKLRAETN
210 220 230 240 250
MVWYDWMKPS HAQLHSDYMQ PLTEAKARSK NKVRSVQQLI QRLRLVKSPS
260 270 280 290 300
EIKRMQIAGK LTSEAFIETM FASKAPIDEA FLYAKFEFEC RARGADILAY
310 320 330 340 350
PPVVAGGNRS NTLHYVKNNQ LIKDGEMVLL DGGCESSCYV SDITRTWPVN
360 370 380 390 400
GRFTAPQAEL YEAVLEIQRA CLTLCSPGTS LENIYSMMLT LIGQKLKDLG
410 420 430 440 450
ITKTSKESAF KAARKYCPHH VGHYLGMDVH DTPDMPRSLP LQPGMVITVE
460 470 480 490 500
PGIYIPEDDR DAPEKFRGLG VRIEDDVVVT QDSPLILSAD CPKEMNDIEQ

ICSRTS
Length:506
Mass (Da):56,677
Last modified:March 3, 2009 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE1F36BDA1F92C023
GO
Isoform 2 (identifier: B7ZMP1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     353-386: FTAPQAELYEAVLEIQRACLTLCSPGTSLENIYS → LLENTALIMLAITSGWMSMTLQTCLGHSLCSLEW
     387-506: Missing.

Show »
Length:386
Mass (Da):43,367
Checksum:iCD47003E01441698
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9Q7I3E9Q7I3_MOUSE
Xaa-Pro aminopeptidase 3
Xpnpep3
69Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_040145353 – 386FTAPQ…ENIYS → LLENTALIMLAITSGWMSMT LQTCLGHSLCSLEW in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_040146387 – 506Missing in isoform 2. 1 PublicationAdd BLAST120

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK088324 mRNA Translation: BAC40282.1
CH466550 Genomic DNA Translation: EDL04573.1
CH466550 Genomic DNA Translation: EDL04574.1
BC137569 mRNA Translation: AAI37570.1
BC144717 mRNA Translation: AAI44718.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS27668.1 [B7ZMP1-2]
CCDS84182.1 [B7ZMP1-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001334004.1, NM_001347075.1 [B7ZMP1-1]
NP_796284.1, NM_177310.2 [B7ZMP1-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000041609; ENSMUSP00000038331; ENSMUSG00000022401 [B7ZMP1-2]
ENSMUST00000163754; ENSMUSP00000132822; ENSMUSG00000022401 [B7ZMP1-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
321003

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:321003

UCSC genome browser

More...
UCSCi
uc007wwo.1 mouse [B7ZMP1-2]
uc011zwj.1 mouse [B7ZMP1-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK088324 mRNA Translation: BAC40282.1
CH466550 Genomic DNA Translation: EDL04573.1
CH466550 Genomic DNA Translation: EDL04574.1
BC137569 mRNA Translation: AAI37570.1
BC144717 mRNA Translation: AAI44718.1
CCDSiCCDS27668.1 [B7ZMP1-2]
CCDS84182.1 [B7ZMP1-1]
RefSeqiNP_001334004.1, NM_001347075.1 [B7ZMP1-1]
NP_796284.1, NM_177310.2 [B7ZMP1-2]

3D structure databases

SMRiB7ZMP1
ModBaseiSearch...

Protein-protein interaction databases

IntActiB7ZMP1, 1 interactor
MINTiB7ZMP1
STRINGi10090.ENSMUSP00000038331

Protein family/group databases

MEROPSiM24.026

PTM databases

iPTMnetiB7ZMP1
PhosphoSitePlusiB7ZMP1
SwissPalmiB7ZMP1

Proteomic databases

EPDiB7ZMP1
jPOSTiB7ZMP1
MaxQBiB7ZMP1
PaxDbiB7ZMP1
PeptideAtlasiB7ZMP1
PRIDEiB7ZMP1

Genome annotation databases

EnsembliENSMUST00000041609; ENSMUSP00000038331; ENSMUSG00000022401 [B7ZMP1-2]
ENSMUST00000163754; ENSMUSP00000132822; ENSMUSG00000022401 [B7ZMP1-1]
GeneIDi321003
KEGGimmu:321003
UCSCiuc007wwo.1 mouse [B7ZMP1-2]
uc011zwj.1 mouse [B7ZMP1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
63929
MGIiMGI:2445217 Xpnpep3

Phylogenomic databases

eggNOGiKOG2414 Eukaryota
COG0006 LUCA
GeneTreeiENSGT00940000153657
HOGENOMiHOG000008762
InParanoidiB7ZMP1
KOiK01262
OMAiTGFNEPN
OrthoDBi352329at2759
TreeFamiTF314484

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Xpnpep3 mouse

Protein Ontology

More...
PROi
PR:B7ZMP1
RNActiB7ZMP1 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000022401 Expressed in 219 organ(s), highest expression level in brown adipose tissue
ExpressionAtlasiB7ZMP1 baseline and differential
GenevisibleiB7ZMP1 MM

Family and domain databases

Gene3Di3.40.350.10, 1 hit
3.90.230.10, 1 hit
InterProiView protein in InterPro
IPR007865 Aminopep_P_N
IPR029149 Creatin/AminoP/Spt16_NTD
IPR036005 Creatinase/aminopeptidase-like
IPR000994 Pept_M24
PfamiView protein in Pfam
PF05195 AMP_N, 1 hit
PF00557 Peptidase_M24, 1 hit
SMARTiView protein in SMART
SM01011 AMP_N, 1 hit
SUPFAMiSSF53092 SSF53092, 1 hit
SSF55920 SSF55920, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiXPP3_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: B7ZMP1
Secondary accession number(s): Q8BHT9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 30, 2010
Last sequence update: March 3, 2009
Last modified: December 11, 2019
This is version 80 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  3. Peptidase families
    Classification of peptidase families and list of entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again