Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Trafficking protein particle complex subunit 11

Gene

Trappc11

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Involved in endoplasmic reticulum to Golgi apparatus trafficking at a very early stage.By similarity

GO - Biological processi

Keywordsi

Biological processER-Golgi transport, Transport

Enzyme and pathway databases

ReactomeiR-MMU-8876198 RAB GEFs exchange GTP for GDP on RABs

Names & Taxonomyi

Protein namesi
Recommended name:
Trafficking protein particle complex subunit 11
Gene namesi
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 8

Organism-specific databases

MGIiMGI:2444585 Trappc11

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Golgi apparatus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003480731 – 1133Trafficking protein particle complex subunit 11Add BLAST1133

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei245N6-acetyllysineBy similarity1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiB2RXC1
MaxQBiB2RXC1
PaxDbiB2RXC1
PeptideAtlasiB2RXC1
PRIDEiB2RXC1

PTM databases

iPTMnetiB2RXC1
PhosphoSitePlusiB2RXC1

Expressioni

Gene expression databases

BgeeiENSMUSG00000038102 Expressed in 241 organ(s), highest expression level in ear vesicle
GenevisibleiB2RXC1 MM

Interactioni

Subunit structurei

Component of the multisubunit TRAPP (transport protein particle) complex, which includes at least TRAPPC2, TRAPPC2L, TRAPPC3, TRAPPC3L, TRAPPC4, TRAPPC5, TRAPPC8, TRAPPC9, TRAPPC10, TRAPPC11 and TRAPPC12.By similarity

Protein-protein interaction databases

BioGridi236237, 13 interactors
IntActiB2RXC1, 13 interactors
STRINGi10090.ENSMUSP00000047562

Structurei

3D structure databases

SMRiB2RXC1
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the TRAPPC11 family.Curated

Phylogenomic databases

eggNOGiKOG4386 Eukaryota
ENOG410XSTE LUCA
GeneTreeiENSGT00390000006550
HOGENOMiHOG000068082
HOVERGENiHBG107625
InParanoidiB2RXC1
KOiK20308
OMAiLAPSMTP
OrthoDBiEOG091G00VZ
PhylomeDBiB2RXC1
TreeFamiTF314022

Family and domain databases

InterProiView protein in InterPro
IPR021773 Foie-gras_1
IPR025876 TRAPPC11_C
PfamiView protein in Pfam
PF11817 Foie-gras_1, 1 hit
PF12742 Gryzun-like, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: B2RXC1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSPTQWDFPV ELCCRPMAFV TLTGLDVVYN AVHRAVWDAF CANRRADRVP
60 70 80 90 100
ISFKVLPGDH EYPKCRSKRT SYEWYIPKGV LKTGWMNKHL NLVPALVVVF
110 120 130 140 150
YELDWDEPQW KEKQSECATR VEIVRQSLQG RNTKVAVVLI QKKTPLPPGE
160 170 180 190 200
DVIASERAAA LCNVCELSGK SLFVLPHTDH LVGYIIRLEN AFYEHAQTYY
210 220 230 240 250
YTEIRRVKSH KEFLNKTTHQ LLFVRHQFKI AFFSELKQDT QNALKNYRIA
260 270 280 290 300
YNLVHELRAH ETNILEIKTM AGFINYKICR LCFQHNTPLD AIAQFRKHID
310 320 330 340 350
LCKKKIGSAE LAFEHAAWMA KQFQAFGDLF DEAIKLGLTA IQTQNPGFYY
360 370 380 390 400
QQAAYYAQER KQHAKALCNH DAAVMYPNPD PLETQSGVLD FYGQRPWRQG
410 420 430 440 450
ILSFDLSDPE KEKAGILAIQ LKERSVVHSE IIIALLSNAV AQFKKYKCPR
460 470 480 490 500
MKSHLMVQMG EEYYYAKDYT KALKLLDYVM CDYRSEAWWT LLTSILTTAL
510 520 530 540 550
KCSYLMAQLK DYITYSLELL GRASTLKDEQ KSRIEKNLMN VLMNESPDPE
560 570 580 590 600
PDCDVLAVKT AQKLWADRVS LAGSNVFQIG VQDFVPFVQC KAKFHAPSFH
610 620 630 640 650
VDVPVEFDVF LKADCPHPIR FSKLCVSFNN QVYNQFCVLE EASKASEVLE
660 670 680 690 700
NLTQGKMCLV PGKTRKLSFK FVAKTEDVGK KIEITSVDLF LGSESGRCVV
710 720 730 740 750
LSWQGGGGDA ASSQEALQAA RSFKRRPKLA EDEIHWDSVI IQASTMIISR
760 770 780 790 800
VPNISVHLRH EPPALMNEMY CLVVTVQSHE KSPIRDVKLT AGLKPGQDAN
810 820 830 840 850
LTQKTHVTLH GAELCDESYP ALLTDIPVGD LHPGEQLEKT VYVRCGTVGS
860 870 880 890 900
RMFLVYVSYL INTTVEGKEI ICKCHKDDTV TIETVFPFDV AVRFVSTKFE
910 920 930 940 950
HLERVYADIP FLLMTDVLSA SPWALTIVSS ELQLAPSMTA MDHLESQIDK
960 970 980 990 1000
VVLQTGESAS ECFCLRCPSA GNIEGGVATG HYIISWKRAS VVESIPAVST
1010 1020 1030 1040 1050
VITLPHVIAE NIPLHVNADL PSFGRVRESL PVRYHLQNKT DLVQDVEISV
1060 1070 1080 1090 1100
EPSDAFMFSG LKQIRLRILP GTKQEMLYNF YPLMAGYQQL PSLNINLLRF
1110 1120 1130
PNFTNQLLRR FIPTSIFVKP QGRLLEDTSI AAA
Length:1,133
Mass (Da):128,396
Last modified:July 1, 2008 - v1
Checksum:i2CF6277990E165CF
GO
Isoform 2 (identifier: B2RXC1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-656: Missing.
     797-832: QDANLTQKTHVTLHGAELCDESYPALLTDIPVGDLH → EHPLYKFLLGVRWTRSHVLWWLKRQCGLFALLKFAM
     833-1133: Missing.

Note: No experimental confirmation available.
Show »
Length:176
Mass (Da):19,785
Checksum:i4021D703AFE528FE
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0351001 – 656Missing in isoform 2. 1 PublicationAdd BLAST656
Alternative sequenceiVSP_035101797 – 832QDANL…VGDLH → EHPLYKFLLGVRWTRSHVLW WLKRQCGLFALLKFAM in isoform 2. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_035102833 – 1133Missing in isoform 2. 1 PublicationAdd BLAST301

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK042816 mRNA Translation: BAC31370.1
BC094246 mRNA Translation: AAH94246.1
BC147504 mRNA Translation: AAI47505.1
BC151159 mRNA Translation: AAI51160.1
CCDSiCCDS22296.1 [B2RXC1-1]
RefSeqiNP_796214.2, NM_177240.3 [B2RXC1-1]
UniGeneiMm.39461

Genome annotation databases

EnsembliENSMUST00000039061; ENSMUSP00000047562; ENSMUSG00000038102 [B2RXC1-1]
ENSMUST00000120987; ENSMUSP00000113779; ENSMUSG00000038102 [B2RXC1-2]
GeneIDi320714
KEGGimmu:320714
UCSCiuc009lra.1 mouse [B2RXC1-1]
uc009lrb.1 mouse [B2RXC1-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK042816 mRNA Translation: BAC31370.1
BC094246 mRNA Translation: AAH94246.1
BC147504 mRNA Translation: AAI47505.1
BC151159 mRNA Translation: AAI51160.1
CCDSiCCDS22296.1 [B2RXC1-1]
RefSeqiNP_796214.2, NM_177240.3 [B2RXC1-1]
UniGeneiMm.39461

3D structure databases

SMRiB2RXC1
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi236237, 13 interactors
IntActiB2RXC1, 13 interactors
STRINGi10090.ENSMUSP00000047562

PTM databases

iPTMnetiB2RXC1
PhosphoSitePlusiB2RXC1

Proteomic databases

EPDiB2RXC1
MaxQBiB2RXC1
PaxDbiB2RXC1
PeptideAtlasiB2RXC1
PRIDEiB2RXC1

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000039061; ENSMUSP00000047562; ENSMUSG00000038102 [B2RXC1-1]
ENSMUST00000120987; ENSMUSP00000113779; ENSMUSG00000038102 [B2RXC1-2]
GeneIDi320714
KEGGimmu:320714
UCSCiuc009lra.1 mouse [B2RXC1-1]
uc009lrb.1 mouse [B2RXC1-2]

Organism-specific databases

CTDi60684
MGIiMGI:2444585 Trappc11

Phylogenomic databases

eggNOGiKOG4386 Eukaryota
ENOG410XSTE LUCA
GeneTreeiENSGT00390000006550
HOGENOMiHOG000068082
HOVERGENiHBG107625
InParanoidiB2RXC1
KOiK20308
OMAiLAPSMTP
OrthoDBiEOG091G00VZ
PhylomeDBiB2RXC1
TreeFamiTF314022

Enzyme and pathway databases

ReactomeiR-MMU-8876198 RAB GEFs exchange GTP for GDP on RABs

Miscellaneous databases

ChiTaRSiTrappc11 mouse
PROiPR:B2RXC1
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000038102 Expressed in 241 organ(s), highest expression level in ear vesicle
GenevisibleiB2RXC1 MM

Family and domain databases

InterProiView protein in InterPro
IPR021773 Foie-gras_1
IPR025876 TRAPPC11_C
PfamiView protein in Pfam
PF11817 Foie-gras_1, 1 hit
PF12742 Gryzun-like, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiTPC11_MOUSE
AccessioniPrimary (citable) accession number: B2RXC1
Secondary accession number(s): B9EJS1, Q52KP8, Q8BXY8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 2, 2008
Last sequence update: July 1, 2008
Last modified: November 7, 2018
This is version 78 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again