Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Trafficking protein particle complex subunit 11

Gene

Trappc11

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in endoplasmic reticulum to Golgi apparatus trafficking at a very early stage.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processER-Golgi transport, Transport

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-8876198 RAB GEFs exchange GTP for GDP on RABs

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Trafficking protein particle complex subunit 11
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2444585 Trappc11

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Golgi apparatus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003480731 – 1133Trafficking protein particle complex subunit 11Add BLAST1133

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei245N6-acetyllysineBy similarity1

Keywords - PTMi

Acetylation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
B2RXC1

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
B2RXC1

MaxQB - The MaxQuant DataBase

More...
MaxQBi
B2RXC1

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
B2RXC1

PeptideAtlas

More...
PeptideAtlasi
B2RXC1

PRoteomics IDEntifications database

More...
PRIDEi
B2RXC1

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
B2RXC1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
B2RXC1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000038102 Expressed in 241 organ(s), highest expression level in ear vesicle

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
B2RXC1 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the multisubunit TRAPP (transport protein particle) complex, which includes at least TRAPPC2, TRAPPC2L, TRAPPC3, TRAPPC3L, TRAPPC4, TRAPPC5, TRAPPC8, TRAPPC9, TRAPPC10, TRAPPC11 and TRAPPC12.By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
236237, 13 interactors

Protein interaction database and analysis system

More...
IntActi
B2RXC1, 13 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000047562

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
B2RXC1

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TRAPPC11 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4386 Eukaryota
ENOG410XSTE LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000006550

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000068082

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG107625

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
B2RXC1

KEGG Orthology (KO)

More...
KOi
K20308

Identification of Orthologs from Complete Genome Data

More...
OMAi
LAPSMTP

Database of Orthologous Groups

More...
OrthoDBi
1065648at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
B2RXC1

TreeFam database of animal gene trees

More...
TreeFami
TF314022

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR021773 TPC11
IPR025876 TRAPPC11_C

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF11817 Foie-gras_1, 1 hit
PF12742 Gryzun-like, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: B2RXC1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSPTQWDFPV ELCCRPMAFV TLTGLDVVYN AVHRAVWDAF CANRRADRVP
60 70 80 90 100
ISFKVLPGDH EYPKCRSKRT SYEWYIPKGV LKTGWMNKHL NLVPALVVVF
110 120 130 140 150
YELDWDEPQW KEKQSECATR VEIVRQSLQG RNTKVAVVLI QKKTPLPPGE
160 170 180 190 200
DVIASERAAA LCNVCELSGK SLFVLPHTDH LVGYIIRLEN AFYEHAQTYY
210 220 230 240 250
YTEIRRVKSH KEFLNKTTHQ LLFVRHQFKI AFFSELKQDT QNALKNYRIA
260 270 280 290 300
YNLVHELRAH ETNILEIKTM AGFINYKICR LCFQHNTPLD AIAQFRKHID
310 320 330 340 350
LCKKKIGSAE LAFEHAAWMA KQFQAFGDLF DEAIKLGLTA IQTQNPGFYY
360 370 380 390 400
QQAAYYAQER KQHAKALCNH DAAVMYPNPD PLETQSGVLD FYGQRPWRQG
410 420 430 440 450
ILSFDLSDPE KEKAGILAIQ LKERSVVHSE IIIALLSNAV AQFKKYKCPR
460 470 480 490 500
MKSHLMVQMG EEYYYAKDYT KALKLLDYVM CDYRSEAWWT LLTSILTTAL
510 520 530 540 550
KCSYLMAQLK DYITYSLELL GRASTLKDEQ KSRIEKNLMN VLMNESPDPE
560 570 580 590 600
PDCDVLAVKT AQKLWADRVS LAGSNVFQIG VQDFVPFVQC KAKFHAPSFH
610 620 630 640 650
VDVPVEFDVF LKADCPHPIR FSKLCVSFNN QVYNQFCVLE EASKASEVLE
660 670 680 690 700
NLTQGKMCLV PGKTRKLSFK FVAKTEDVGK KIEITSVDLF LGSESGRCVV
710 720 730 740 750
LSWQGGGGDA ASSQEALQAA RSFKRRPKLA EDEIHWDSVI IQASTMIISR
760 770 780 790 800
VPNISVHLRH EPPALMNEMY CLVVTVQSHE KSPIRDVKLT AGLKPGQDAN
810 820 830 840 850
LTQKTHVTLH GAELCDESYP ALLTDIPVGD LHPGEQLEKT VYVRCGTVGS
860 870 880 890 900
RMFLVYVSYL INTTVEGKEI ICKCHKDDTV TIETVFPFDV AVRFVSTKFE
910 920 930 940 950
HLERVYADIP FLLMTDVLSA SPWALTIVSS ELQLAPSMTA MDHLESQIDK
960 970 980 990 1000
VVLQTGESAS ECFCLRCPSA GNIEGGVATG HYIISWKRAS VVESIPAVST
1010 1020 1030 1040 1050
VITLPHVIAE NIPLHVNADL PSFGRVRESL PVRYHLQNKT DLVQDVEISV
1060 1070 1080 1090 1100
EPSDAFMFSG LKQIRLRILP GTKQEMLYNF YPLMAGYQQL PSLNINLLRF
1110 1120 1130
PNFTNQLLRR FIPTSIFVKP QGRLLEDTSI AAA
Length:1,133
Mass (Da):128,396
Last modified:July 1, 2008 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i2CF6277990E165CF
GO
Isoform 2 (identifier: B2RXC1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-656: Missing.
     797-832: QDANLTQKTHVTLHGAELCDESYPALLTDIPVGDLH → EHPLYKFLLGVRWTRSHVLWWLKRQCGLFALLKFAM
     833-1133: Missing.

Note: No experimental confirmation available.
Show »
Length:176
Mass (Da):19,785
Checksum:i4021D703AFE528FE
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0351001 – 656Missing in isoform 2. 1 PublicationAdd BLAST656
Alternative sequenceiVSP_035101797 – 832QDANL…VGDLH → EHPLYKFLLGVRWTRSHVLW WLKRQCGLFALLKFAM in isoform 2. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_035102833 – 1133Missing in isoform 2. 1 PublicationAdd BLAST301

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK042816 mRNA Translation: BAC31370.1
BC094246 mRNA Translation: AAH94246.1
BC147504 mRNA Translation: AAI47505.1
BC151159 mRNA Translation: AAI51160.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS22296.1 [B2RXC1-1]

NCBI Reference Sequences

More...
RefSeqi
NP_796214.2, NM_177240.3 [B2RXC1-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Mm.39461

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000039061; ENSMUSP00000047562; ENSMUSG00000038102 [B2RXC1-1]
ENSMUST00000120987; ENSMUSP00000113779; ENSMUSG00000038102 [B2RXC1-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
320714

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:320714

UCSC genome browser

More...
UCSCi
uc009lra.1 mouse [B2RXC1-1]
uc009lrb.1 mouse [B2RXC1-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK042816 mRNA Translation: BAC31370.1
BC094246 mRNA Translation: AAH94246.1
BC147504 mRNA Translation: AAI47505.1
BC151159 mRNA Translation: AAI51160.1
CCDSiCCDS22296.1 [B2RXC1-1]
RefSeqiNP_796214.2, NM_177240.3 [B2RXC1-1]
UniGeneiMm.39461

3D structure databases

SMRiB2RXC1
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi236237, 13 interactors
IntActiB2RXC1, 13 interactors
STRINGi10090.ENSMUSP00000047562

PTM databases

iPTMnetiB2RXC1
PhosphoSitePlusiB2RXC1

Proteomic databases

EPDiB2RXC1
jPOSTiB2RXC1
MaxQBiB2RXC1
PaxDbiB2RXC1
PeptideAtlasiB2RXC1
PRIDEiB2RXC1

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000039061; ENSMUSP00000047562; ENSMUSG00000038102 [B2RXC1-1]
ENSMUST00000120987; ENSMUSP00000113779; ENSMUSG00000038102 [B2RXC1-2]
GeneIDi320714
KEGGimmu:320714
UCSCiuc009lra.1 mouse [B2RXC1-1]
uc009lrb.1 mouse [B2RXC1-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
60684
MGIiMGI:2444585 Trappc11

Phylogenomic databases

eggNOGiKOG4386 Eukaryota
ENOG410XSTE LUCA
GeneTreeiENSGT00390000006550
HOGENOMiHOG000068082
HOVERGENiHBG107625
InParanoidiB2RXC1
KOiK20308
OMAiLAPSMTP
OrthoDBi1065648at2759
PhylomeDBiB2RXC1
TreeFamiTF314022

Enzyme and pathway databases

ReactomeiR-MMU-8876198 RAB GEFs exchange GTP for GDP on RABs

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Trappc11 mouse

Protein Ontology

More...
PROi
PR:B2RXC1

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000038102 Expressed in 241 organ(s), highest expression level in ear vesicle
GenevisibleiB2RXC1 MM

Family and domain databases

InterProiView protein in InterPro
IPR021773 TPC11
IPR025876 TRAPPC11_C
PfamiView protein in Pfam
PF11817 Foie-gras_1, 1 hit
PF12742 Gryzun-like, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTPC11_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: B2RXC1
Secondary accession number(s): B9EJS1, Q52KP8, Q8BXY8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 2, 2008
Last sequence update: July 1, 2008
Last modified: January 16, 2019
This is version 80 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again