Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 79 (16 Jan 2019)
Sequence version 2 (30 Nov 2010)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Centrosome and spindle pole associated protein 1

Gene

Cspp1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May play a role in cell-cycle-dependent microtubule organization.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Centrosome and spindle pole associated protein 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Cspp1
Synonyms:Cspp
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2681832 Cspp1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00004011921 – 1205Centrosome and spindle pole associated protein 1Add BLAST1205

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei405PhosphoserineCombined sources1
Modified residuei850PhosphoserineBy similarity1
Modified residuei869PhosphoserineBy similarity1
Modified residuei915PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated. Phosphorylation increases in colcemide-treated cells (By similarity).By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQB - The MaxQuant DataBase

More...
MaxQBi
B2RX88

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
B2RX88

PeptideAtlas

More...
PeptideAtlasi
B2RX88

PRoteomics IDEntifications database

More...
PRIDEi
B2RX88

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
B2RX88

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
B2RX88

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000056763 Expressed in 253 organ(s), highest expression level in metanephric cortical collecting duct

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
B2RX88 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
B2RX88 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with PLEKHG6.1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
229256, 1 interactor

Protein interaction database and analysis system

More...
IntActi
B2RX88, 1 interactor

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000068804

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
B2RX88

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili12 – 34Sequence analysisAdd BLAST23
Coiled coili87 – 108Sequence analysisAdd BLAST22
Coiled coili357 – 391Sequence analysisAdd BLAST35
Coiled coili574 – 618Sequence analysisAdd BLAST45
Coiled coili724 – 813Sequence analysisAdd BLAST90
Coiled coili874 – 911Sequence analysisAdd BLAST38
Coiled coili993 – 1014Sequence analysisAdd BLAST22

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi423 – 491Pro-richAdd BLAST69
Compositional biasi621 – 626Poly-Gly6
Compositional biasi728 – 804Glu-richAdd BLAST77

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IFHQ Eukaryota
ENOG4111FD8 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000015084

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000060302

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG064805

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
B2RX88

KEGG Orthology (KO)

More...
KOi
K16771

Identification of Orthologs from Complete Genome Data

More...
OMAi
GHMQTQS

Database of Orthologous Groups

More...
OrthoDBi
1439603at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
B2RX88

TreeFam database of animal gene trees

More...
TreeFami
TF335475

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR026708 CSPP1

The PANTHER Classification System

More...
PANTHERi
PTHR21616 PTHR21616, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: B2RX88-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MADSLDEFIE EQKAKLAKDK AELESDPPYM EMKGKASEKL SENSKILISM
60 70 80 90 100
AKENIPPSSQ QQPKGPLGIE YGLSLPLGED YEQKKHKLKE ELRQDYRRYL
110 120 130 140 150
TQGITQAKRK KNFLSTGETD PSTLGVSLPI DERLSAKERL KLERNREYNQ
160 170 180 190 200
FLRGKAESTE KVRQVEKNIE PKSQRNKNPI SQGKSDLPLQ IQTAYTHSEG
210 220 230 240 250
PWLSRQEEGL YRQLDGEIEL RSRRPLKQTK EEVGISGAEH PSLSGSAGVP
260 270 280 290 300
ERRARRANGE RVLDRQHCRA DRDPGVSEDM DERFRFESDF DRRLLRVYTN
310 320 330 340 350
GRPHGSRRGY VDGDDVPEEP NTQISAAENK SVHCNGPPRS ADLDITSPFA
360 370 380 390 400
GMLFGGEDRE LTKRRKEKYR QELLEQIAEQ QKKKRREKDL AFGITTSGVQ
410 420 430 440 450
DPEKSPDRLK QFSLTPRHFE EMPPERPRVA FQTPPPPFSA PSSPSVPPVH
460 470 480 490 500
SAPSHNEDLH SGLGSTLGEL AHPRVLPVPL NPPPPPLLAP PASNYRTPYD
510 520 530 540 550
DAYYFYGARN TLDPNIVYYG SGMIGGQPAP HVSAPVTHQV APPAVNTVGQ
560 570 580 590 600
NEQKVLSDGL RNSGLVFEDK PKPSTQSLQS YQEALQEQIR EREARRKKER
610 620 630 640 650
LEKEEYEAKL EAEMRIYNPW GKGGGGAPLR DAKGNLITDL NRMHRQNIDA
660 670 680 690 700
YHNPDARTYE DKRAVVSIDQ NLATSNAENL EDSANKNSGP LQTQSSPFAR
710 720 730 740 750
GNTFGEPLSE LQIKQQELYK NFLRFQIEEK RQREEAEREK LRVAEEKEEK
760 770 780 790 800
RLAEQRARIQ QEYEEEQERR REKEEEQRLK NEELIRLAEE RRKEAERKKK
810 820 830 840 850
EEEEKHNLQL QHYYERENII GDETKHLRQP SPVVPALQNK IASKLQRPPS
860 870 880 890 900
VDTIISSFIH ESSMSRAQSP PVPARKNQLR AEEEKKNVIM ELSEMRKQLR
910 920 930 940 950
SEERRLQGRL LHLDSDDEIP MRKRERNPMD IFDMARHRVQ APVRRPSPKG
960 970 980 990 1000
LDATTFQNIH DFNELRERDS DTRVDLRLMY PDPPRDHHTL EIQQQALLRE
1010 1020 1030 1040 1050
QQKRLNRIKM RRDAGADLDT ICTDNAQGRR MPRDDTNDFL KNSLLESDSA
1060 1070 1080 1090 1100
FIGAYGETYP VIEDNAFPPP SQLPSARERR RNKLKGLDFD SSRLHTPQDG
1110 1120 1130 1140 1150
LSLKSISSVN VDQVRMRNED RMRRLTEQQK KPTNTDDEGS LVDPDDIMRH
1160 1170 1180 1190 1200
LSDDGRNSAA TEPWLRPGTS ESLKRFMAEH LNEEQHKGPG KPGTFTWQGL

SAAHA
Length:1,205
Mass (Da):138,312
Last modified:November 30, 2010 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0668152BE28543CB
GO
Isoform 2 (identifier: B2RX88-2) [UniParc]FASTAAdd to basket
Also known as: Cspp2

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MADSLDEFIEEQKAKLAKDKAELESDPPYMEMK → MDLNCYPHLVAGHAHSYLIWR
     638-689: TDLNRMHRQNIDAYHNPDARTYEDKRAVVSIDQNLATSNAENLEDSANKNSG → S

Show »
Length:1,142
Mass (Da):131,209
Checksum:iFB31DE3DCA6344B4
GO
Isoform 3 (identifier: B2RX88-3) [UniParc]FASTAAdd to basket
Also known as: Cspp3

The sequence of this isoform differs from the canonical sequence as follows:
     103-110: Missing.
     406-424: PDRLKQFSLTPRHFEEMPP → GSACASESTPASAPCPPSSF
     425-1205: Missing.

Show »
Length:417
Mass (Da):47,245
Checksum:i355AA89EDDBE74EF
GO
Isoform 4 (identifier: B2RX88-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     103-110: Missing.

Show »
Length:1,197
Mass (Da):137,429
Checksum:iC4985238A0BFD736
GO
Isoform 5 (identifier: B2RX88-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     303-319: PHGSRRGYVDGDDVPEE → YLHLHFSSLYLLNTGVL
     320-1205: Missing.

Show »
Length:319
Mass (Da):36,713
Checksum:i5B4848F1F6637DF7
GO
Isoform 6 (identifier: B2RX88-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     103-110: Missing.
     303-319: PHGSRRGYVDGDDVPEE → YLHLHFSSLYLLNTGVL
     320-1205: Missing.

Show »
Length:311
Mass (Da):35,830
Checksum:i9B571209DB5E91C5
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D3Z378D3Z378_MOUSE
Centrosome and spindle pole-associa...
Cspp1
102Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WQ80A0A087WQ80_MOUSE
Centrosome and spindle pole-associa...
Cspp1
264Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WS14A0A087WS14_MOUSE
Centrosome and spindle pole-associa...
Cspp1
70Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WRQ0A0A087WRQ0_MOUSE
Centrosome and spindle pole-associa...
Cspp1
105Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6QJJ3F6QJJ3_MOUSE
Centrosome and spindle pole-associa...
Cspp1
153Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti259G → E in AAH19581 (PubMed:15489334).Curated1
Sequence conflicti324I → V in ACM46986 (Ref. 1) Curated1
Sequence conflicti358D → G in ACM46985 (Ref. 1) Curated1
Sequence conflicti394I → V in ACM46985 (Ref. 1) Curated1
Sequence conflicti412F → S in ACM46985 (Ref. 1) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0400731 – 33MADSL…YMEMK → MDLNCYPHLVAGHAHSYLIW R in isoform 2. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_040074103 – 110Missing in isoform 3, isoform 4 and isoform 6. 3 Publications8
Alternative sequenceiVSP_040075303 – 319PHGSR…DVPEE → YLHLHFSSLYLLNTGVL in isoform 5 and isoform 6. 2 PublicationsAdd BLAST17
Alternative sequenceiVSP_040076320 – 1205Missing in isoform 5 and isoform 6. 2 PublicationsAdd BLAST886
Alternative sequenceiVSP_040077406 – 424PDRLK…EEMPP → GSACASESTPASAPCPPSSF in isoform 3. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_040078425 – 1205Missing in isoform 3. 1 PublicationAdd BLAST781
Alternative sequenceiVSP_040079638 – 689TDLNR…NKNSG → S in isoform 2. 1 PublicationAdd BLAST52

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
FJ008677 mRNA Translation: ACM46986.1
FJ008676 mRNA Translation: ACM46985.1
AK013065 mRNA Translation: BAB28630.1
AK015133 mRNA Translation: BAB29721.1
AK032310 mRNA Translation: BAC27806.1
AC102570 Genomic DNA No translation available.
AC159972 Genomic DNA No translation available.
CH466536 Genomic DNA Translation: EDL14300.1
CH466536 Genomic DNA Translation: EDL14303.1
BC019581 mRNA Translation: AAH19581.1
BC151042 mRNA Translation: AAI51043.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS35511.1 [B2RX88-4]

NCBI Reference Sequences

More...
RefSeqi
NP_080769.3, NM_026493.3 [B2RX88-4]
XP_006495545.1, XM_006495482.3 [B2RX88-1]
XP_006495546.1, XM_006495483.3 [B2RX88-4]
XP_006495547.1, XM_006495484.3 [B2RX88-4]
XP_006495549.1, XM_006495486.2 [B2RX88-1]
XP_011236667.1, XM_011238365.2 [B2RX88-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Mm.244046

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000071087; ENSMUSP00000068804; ENSMUSG00000056763 [B2RX88-4]
ENSMUST00000117415; ENSMUSP00000112800; ENSMUSG00000056763 [B2RX88-6]
ENSMUST00000118263; ENSMUSP00000112476; ENSMUSG00000056763 [B2RX88-6]
ENSMUST00000119714; ENSMUSP00000114091; ENSMUSG00000056763 [B2RX88-6]
ENSMUST00000122156; ENSMUSP00000113663; ENSMUSG00000056763 [B2RX88-5]
ENSMUST00000186294; ENSMUSP00000139775; ENSMUSG00000056763 [B2RX88-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
211660

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:211660

UCSC genome browser

More...
UCSCi
uc007ahh.1 mouse [B2RX88-6]
uc007ahi.1 mouse [B2RX88-4]
uc007ahj.1 mouse [B2RX88-5]
uc011wig.1 mouse [B2RX88-3]
uc011wih.1 mouse [B2RX88-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
FJ008677 mRNA Translation: ACM46986.1
FJ008676 mRNA Translation: ACM46985.1
AK013065 mRNA Translation: BAB28630.1
AK015133 mRNA Translation: BAB29721.1
AK032310 mRNA Translation: BAC27806.1
AC102570 Genomic DNA No translation available.
AC159972 Genomic DNA No translation available.
CH466536 Genomic DNA Translation: EDL14300.1
CH466536 Genomic DNA Translation: EDL14303.1
BC019581 mRNA Translation: AAH19581.1
BC151042 mRNA Translation: AAI51043.1
CCDSiCCDS35511.1 [B2RX88-4]
RefSeqiNP_080769.3, NM_026493.3 [B2RX88-4]
XP_006495545.1, XM_006495482.3 [B2RX88-1]
XP_006495546.1, XM_006495483.3 [B2RX88-4]
XP_006495547.1, XM_006495484.3 [B2RX88-4]
XP_006495549.1, XM_006495486.2 [B2RX88-1]
XP_011236667.1, XM_011238365.2 [B2RX88-2]
UniGeneiMm.244046

3D structure databases

SMRiB2RX88
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi229256, 1 interactor
IntActiB2RX88, 1 interactor
STRINGi10090.ENSMUSP00000068804

PTM databases

iPTMnetiB2RX88
PhosphoSitePlusiB2RX88

Proteomic databases

MaxQBiB2RX88
PaxDbiB2RX88
PeptideAtlasiB2RX88
PRIDEiB2RX88

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
211660
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000071087; ENSMUSP00000068804; ENSMUSG00000056763 [B2RX88-4]
ENSMUST00000117415; ENSMUSP00000112800; ENSMUSG00000056763 [B2RX88-6]
ENSMUST00000118263; ENSMUSP00000112476; ENSMUSG00000056763 [B2RX88-6]
ENSMUST00000119714; ENSMUSP00000114091; ENSMUSG00000056763 [B2RX88-6]
ENSMUST00000122156; ENSMUSP00000113663; ENSMUSG00000056763 [B2RX88-5]
ENSMUST00000186294; ENSMUSP00000139775; ENSMUSG00000056763 [B2RX88-2]
GeneIDi211660
KEGGimmu:211660
UCSCiuc007ahh.1 mouse [B2RX88-6]
uc007ahi.1 mouse [B2RX88-4]
uc007ahj.1 mouse [B2RX88-5]
uc011wig.1 mouse [B2RX88-3]
uc011wih.1 mouse [B2RX88-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
79848
MGIiMGI:2681832 Cspp1

Phylogenomic databases

eggNOGiENOG410IFHQ Eukaryota
ENOG4111FD8 LUCA
GeneTreeiENSGT00390000015084
HOGENOMiHOG000060302
HOVERGENiHBG064805
InParanoidiB2RX88
KOiK16771
OMAiGHMQTQS
OrthoDBi1439603at2759
PhylomeDBiB2RX88
TreeFamiTF335475

Miscellaneous databases

Protein Ontology

More...
PROi
PR:B2RX88

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000056763 Expressed in 253 organ(s), highest expression level in metanephric cortical collecting duct
ExpressionAtlasiB2RX88 baseline and differential
GenevisibleiB2RX88 MM

Family and domain databases

InterProiView protein in InterPro
IPR026708 CSPP1
PANTHERiPTHR21616 PTHR21616, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCSPP1_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: B2RX88
Secondary accession number(s): C7SBE3
, C7SBE4, Q8CCQ4, Q8VE83, Q9CQD5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 30, 2010
Last sequence update: November 30, 2010
Last modified: January 16, 2019
This is version 79 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again