Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 110 (13 Feb 2019)
Sequence version 2 (18 May 2010)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Unconventional myosin-IXa

Gene

MYO9A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Regulates Rho by stimulating it's GTPase activity in neurons, has a role in the regulation of neuronal morphology and function.By similarity

Caution

Represents an unconventional myosin. This protein should not be confused with the conventional myosin-9 (MYH9).Curated

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi239 – 246ATPSequence analysis8
<p>This subsection of the ‘Function’ section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri1999 – 2048Phorbol-ester/DAG-type 1PROSITE-ProRule annotationAdd BLAST50
Zinc fingeri2068 – 2119Phorbol-ester/DAG-type 2PROSITE-ProRule annotationAdd BLAST52

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

  • bioluminescence Source: UniProtKB-KW
  • cell junction assembly Source: UniProtKB
  • establishment of epithelial cell apical/basal polarity Source: UniProtKB
  • intracellular signal transduction Source: InterPro
  • regulation of small GTPase mediated signal transduction Source: Reactome
  • visual perception Source: ProtInc

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActin-binding, GTPase activation, Motor protein, Myosin, Photoprotein
Biological processLuminescence
LigandATP-binding, Metal-binding, Nucleotide-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-194840 Rho GTPase cycle

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Unconventional myosin-IXa
Alternative name(s):
Unconventional myosin-9a
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MYO9A
Synonyms:MYR7
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 15

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000066933.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:7608 MYO9A

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
604875 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_B2RTY4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei175 – 195HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Cytoplasm, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

GeneReviews a resource of expert-authored, peer-reviewed disease descriptions.

More...
GeneReviewsi
MYO9A

MalaCards human disease database

More...
MalaCardsi
MYO9A

Open Targets

More...
OpenTargetsi
ENSG00000066933

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
98914 Presynaptic congenital myasthenic syndromes

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA31413

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MYO9A

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003484401 – 2548Unconventional myosin-IXaAdd BLAST2548

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei755PhosphoserineBy similarity1
Modified residuei1242PhosphoserineBy similarity1
Modified residuei1258PhosphoserineBy similarity1
Modified residuei1299PhosphoserineCombined sources1
Modified residuei1317PhosphoserineCombined sources1
Modified residuei1364PhosphoserineCombined sources1
Modified residuei1948PhosphoserineBy similarity1
Modified residuei2294PhosphoserineCombined sources1
Modified residuei2464PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated by ALPK1 following monosodium urate monohydrate (MSU)-induced inflammation.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
B2RTY4

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
B2RTY4

MaxQB - The MaxQuant DataBase

More...
MaxQBi
B2RTY4

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
B2RTY4

PRoteomics IDEntifications database

More...
PRIDEi
B2RTY4

ProteomicsDB human proteome resource

More...
ProteomicsDBi
3450
3451 [B2RTY4-2]
3452 [B2RTY4-3]
3453 [B2RTY4-4]
3454 [B2RTY4-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
B2RTY4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
B2RTY4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Found to be expressed in testis and placenta, and at lower levels in all the examined tissues with the exception of liver (PubMed:10409426). Isoform 5: Found in leukocytes but not in brain, retina or testis (PubMed:10409426).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000066933 Expressed in 236 organ(s), highest expression level in stomach

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
B2RTY4 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
B2RTY4 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA039812
HPA040071

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
110733, 34 interactors

Protein interaction database and analysis system

More...
IntActi
B2RTY4, 10 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000348349

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
B2RTY4

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini14 – 112Ras-associatingPROSITE-ProRule annotationAdd BLAST99
Domaini146 – 1016Myosin motorPROSITE-ProRule annotationAdd BLAST871
Domaini1021 – 1041IQ 1PROSITE-ProRule annotationAdd BLAST21
Domaini1042 – 1071IQ 2PROSITE-ProRule annotationAdd BLAST30
Domaini1074 – 1103IQ 3PROSITE-ProRule annotationAdd BLAST30
Domaini1115 – 1144IQ 4PROSITE-ProRule annotationAdd BLAST30
Domaini1138 – 1167IQ 5PROSITE-ProRule annotationAdd BLAST30
Domaini2063 – 2251Rho-GAPPROSITE-ProRule annotationAdd BLAST189

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni907 – 918Actin-bindingBy similarityAdd BLAST12
Regioni1021 – 1162Neck or regulatory domainAdd BLAST142
Regioni1163 – 2511TailAdd BLAST1349

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili1264 – 1291Sequence analysisAdd BLAST28
Coiled coili1486 – 1532Sequence analysisAdd BLAST47
Coiled coili2315 – 2358Sequence analysisAdd BLAST44

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri1999 – 2048Phorbol-ester/DAG-type 1PROSITE-ProRule annotationAdd BLAST50
Zinc fingeri2068 – 2119Phorbol-ester/DAG-type 2PROSITE-ProRule annotationAdd BLAST52

Keywords - Domaini

Coiled coil, Repeat, Transmembrane, Transmembrane helix, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1453 Eukaryota
KOG4229 Eukaryota
COG5022 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154905

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG108165

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
B2RTY4

KEGG Orthology (KO)

More...
KOi
K10360

Identification of Orthologs from Complete Genome Data

More...
OMAi
KPRIGEC

Database of Orthologous Groups

More...
OrthoDBi
14881at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
B2RTY4

TreeFam database of animal gene trees

More...
TreeFami
TF316834

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00029 C1, 1 hit
cd01385 MYSc_Myo9, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.555.10, 1 hit
3.40.850.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000048 IQ_motif_EF-hand-BS
IPR036961 Kinesin_motor_dom_sf
IPR028558 MYO9A
IPR001609 Myosin_head_motor_dom
IPR036023 MYSc_Myo9
IPR027417 P-loop_NTPase
IPR002219 PE/DAG-bd
IPR000159 RA_dom
IPR008936 Rho_GTPase_activation_prot
IPR000198 RhoGAP_dom
IPR029071 Ubiquitin-like_domsf

The PANTHER Classification System

More...
PANTHERi
PTHR13140:SF9 PTHR13140:SF9, 2 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00612 IQ, 4 hits
PF00063 Myosin_head, 2 hits
PF00788 RA, 1 hit
PF00620 RhoGAP, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00193 MYOSINHEAVY

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00109 C1, 1 hit
SM00015 IQ, 5 hits
SM00242 MYSc, 1 hit
SM00314 RA, 1 hit
SM00324 RhoGAP, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48350 SSF48350, 1 hit
SSF52540 SSF52540, 2 hits
SSF54236 SSF54236, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50096 IQ, 4 hits
PS51456 MYOSIN_MOTOR, 1 hit
PS50200 RA, 1 hit
PS50238 RHOGAP, 1 hit
PS00479 ZF_DAG_PE_1, 1 hit
PS50081 ZF_DAG_PE_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: B2RTY4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNINDGGRRR FEDNEHTLRI YPGAISEGTI YCPIPARKNS TAAEVIESLI
60 70 80 90 100
NKLHLDKTKC YVLAEVKEFG GEEWILNPTD CPVQRMMLWP RMALENRLSG
110 120 130 140 150
EDYRFLLREK NLDGSIHYGS LQSWLRVTEE RRRMMERGFL PQPQQKDFDD
160 170 180 190 200
LCSLPDLNEK TLLENLRNRF KHEKIYTYVG SILIVINPFK FLPIYNPKYV
210 220 230 240 250
KMYDNHQLGK LEPHIYAVAD VAYHAMLQRK KNQCIVISGE SGSGKTQSTN
260 270 280 290 300
FLIHHLTALS QKGFASGVEQ IILGAGPVLE AFGNAKTAHN NNSSRFGKFI
310 320 330 340 350
QVNYQETGTV LGAYVEKYLL EKSRLVYQEH NERNYHVFYY LLAGASEDER
360 370 380 390 400
SAFHLKQPEE YHYLNQITKK PLRQSWDDYC YDSEPDCFTV EGEDLRHDFE
410 420 430 440 450
RLQLAMEMVG FLPKTRRQIF SLLSAILHLG NICYKKKTYR DDSIDICNPE
460 470 480 490 500
VLPIVSELLE VKEEMLFEAL VTRKTVTVGE KLILPYKLAE AVTVRNSMAK
510 520 530 540 550
SLYSALFDWI VFRINHALLN SKDLEHNTKT LSIGVLDIFG FEDYENNSFE
560 570 580 590 600
QFCINFANER LQHYFNQHIF KLEQEEYRTE GISWHNIDYI DNTCCINLIS
610 620 630 640 650
KKPTGLLHLL DEESNFPQAT NQTLLDKFKH QHEDNSYIEF PAVMEPAFII
660 670 680 690 700
KHYAGKVKYG VKDFREKNTD HMRPDIVALL RSSKNAFISG MIGIDPVAVF
710 720 730 740 750
RWAILRAFFR AMVAFREAGK RNIHRKTGHD DTAPCAILKS MDSFSFLQHP
760 770 780 790 800
VHQRSLEILQ RCKEEKYSIT RKNPRTPLSD LQGMNALNEK NQHDTFDIAW
810 820 830 840 850
NGRTGIRQSR LSSGTSLLDK DGIFANSTSS KLLERAHGIL TRNKNFKSKP
860 870 880 890 900
ALPKHLLEVN SLKHLTRLTL QDRITKSLLH LHKKKKPPSI SAQFQASLSK
910 920 930 940 950
LMETLGQAEP YFVKCIRSNA EKLPLRFSDV LVLRQLRYTG MLETVRIRQS
960 970 980 990 1000
GYSSKYSFQD FVSHFHVLLP RNIIPSKFNI QDFFRKINLN PDNYQVGKTM
1010 1020 1030 1040 1050
VFLKEQERQH LQDLLHQEVL RRIILLQRWF RVLLCRQHFL HLRQASVIIQ
1060 1070 1080 1090 1100
RFWRNYLNQK QVRDAAVQKD AFVMASAAAL LQASWRAHLE RQRYLELRAA
1110 1120 1130 1140 1150
AIVIQQKWRD YYRRRHMAAI CIQARWKAYR ESKRYQEQRK KIILLQSTCR
1160 1170 1180 1190 1200
GFRARQRFKA LKEQRLRETK PEVGLVNIKG YGSLEIQGSD PSGWEDCSFD
1210 1220 1230 1240 1250
NRIKAIEECK SVIESNRISR ESSVDCLKES PNKQQERAQS QSGVDLQEDV
1260 1270 1280 1290 1300
LVRERPRSLE DLHQKKVGRA KRESRRMREL EQAIFSLELL KVRSLGGISP
1310 1320 1330 1340 1350
SEDRRWSTEL VPEGLQSPRG TPDSESSQGS LELLSYEESQ KSKLESVISD
1360 1370 1380 1390 1400
EGDLQFPSPK ISSSPKFDSR DNALSASNET SSAEHLKDGT MKEMVVCSSE
1410 1420 1430 1440 1450
SITCKPQLKD SFISNSLPTF FYIPQQDPLK TNSQLDTSIQ RNKLLENEDT
1460 1470 1480 1490 1500
AGEALTLDIN RETRRYHCSG KDQIVPSLNT ESSNPVLKKL EKLNTEKEER
1510 1520 1530 1540 1550
QKQLQQQNEK EMMEQIRQQT DILEKERKAF KTIEKPRIGE CLVAPSSYQS
1560 1570 1580 1590 1600
KQRVERPSSL LSLNTSNKGE LNVLGSLSLK DAALAQKDSS SAHLPPKDRP
1610 1620 1630 1640 1650
VTVFFERKGS PCQSSTVKEL SKTDRMGTQL NVACKLSNNR ISKREHFRPT
1660 1670 1680 1690 1700
QSYSHNSDDL SREGNARPIF FTPKDNMSIP LVSKEALNSK NPQLHKEDEP
1710 1720 1730 1740 1750
AWKPVKLAGP GQRETSQRFS SVDEQAKLHK TMSQGEITKL AVRQKASDSD
1760 1770 1780 1790 1800
IRPQRAKMRF WAKGKQGEKK TTRVKPTTQS EVSPLFAGTD VIPAHQFPDE
1810 1820 1830 1840 1850
LAAYHPTPPL SPELPGSCRK EFKENKEPSP KAKRKRSVKI SNVALDSMHW
1860 1870 1880 1890 1900
QNDSVQIIAS VSDLKSMDEF LLKKVNDLDN EDSKKDTLVD VVFKKALKEF
1910 1920 1930 1940 1950
RQNIFSFYSS ALAMDDGKSI RYKDLYALFE QILEKTMRLE QRDSLGESPV
1960 1970 1980 1990 2000
RVWVNTFKVF LDEYMNEFKT SDCTATKVPK TERKKRRKKE TDLVEEHNGH
2010 2020 2030 2040 2050
IFKATQYSIP TYCEYCSSLI WIMDRASVCK LCKYACHKKC CLKTTAKCSK
2060 2070 2080 2090 2100
KYDPELSSRQ FGVELSRLTS EDRTVPLVVE KLINYIEMHG LYTEGIYRKS
2110 2120 2130 2140 2150
GSTNKIKELR QGLDTDAESV NLDDYNIHVI ASVFKQWLRD LPNPLMTFEL
2160 2170 2180 2190 2200
YEEFLRAMGL QERKETIRGV YSVIDQLSRT HLNTLERLIF HLVRIALQED
2210 2220 2230 2240 2250
TNRMSANALA IVFAPCILRC PDTTDPLQSV QDISKTTTCV ELIVVEQMNK
2260 2270 2280 2290 2300
YKARLKDISS LEFAENKAKT RLSLIRRSMG KGRIRRGNYP GPSSPVVVRL
2310 2320 2330 2340 2350
PSVSDVSEET LTSEAAMETD ITEQQQAAMQ QEERVLTEQI ENLQKEKEEL
2360 2370 2380 2390 2400
TFEMLVLEPR ASDDETLESE ASIGTADSSE NLNMESEYAI SEKSERSLAL
2410 2420 2430 2440 2450
SSLKTAGKSE PSSKLRKQLK KQQDSLDVVD SSVSSLCLSN TASSHGTRKL
2460 2470 2480 2490 2500
FQIYSKSPFY RAASGNEALG MEGPLGQTKF LEDKPQFISR GTFNPEKGKQ
2510 2520 2530 2540
KLKNVKNSPQ KTKETPEGTV MSGRRKTVDP DCTSNQQLAL FGNNEFMV
Length:2,548
Mass (Da):292,706
Last modified:May 18, 2010 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i867835BD2B841C84
GO
Isoform 2 (identifier: B2RTY4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     367-385: Missing.

Note: No experimental confirmation available.
Show »
Length:2,529
Mass (Da):290,379
Checksum:i6024586FEA633B1C
GO
Isoform 3 (identifier: B2RTY4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     729-729: H → K
     730-2548: Missing.

Note: No experimental confirmation available.
Show »
Length:729
Mass (Da):84,679
Checksum:iC7529CD8EB711767
GO
Isoform 4 (identifier: B2RTY4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1714-1714: E → EVARPAHKKKARMARTRSDFLTRGTFADGEGDTEEDDYDDIIEPLLSLDQASHCELGPAPSLGQASHSDSEM

Show »
Length:2,619
Mass (Da):300,433
Checksum:iE19A84D21D057FB0
GO
Isoform 5 (identifier: B2RTY4-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     45-280: Missing.

Note: Lacks the ATP-binding domain which suggests that it cannot interact with actin.
Show »
Length:2,312
Mass (Da):265,414
Checksum:iD00A255132D264DC
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H3BRD5H3BRD5_HUMAN
Unconventional myosin-IXa
MYO9A
2,396Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BMM1H3BMM1_HUMAN
Unconventional myosin-IXa
MYO9A
1,301Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BTL9H3BTL9_HUMAN
Unconventional myosin-IXa
MYO9A
90Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BV44H3BV44_HUMAN
Unconventional myosin-IXa
MYO9A
1,398Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BU05H3BU05_HUMAN
Unconventional myosin-IXa
MYO9A
463Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BP49H3BP49_HUMAN
Unconventional myosin-IXa
MYO9A
194Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BMS3H3BMS3_HUMAN
Unconventional myosin-IXa
MYO9A
140Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BSU8H3BSU8_HUMAN
Unconventional myosin-IXa
MYO9A
73Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA91979 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAB14517 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti88L → R in CAA04947 (PubMed:9819351).Curated1
Sequence conflicti94L → Q in CAA04947 (PubMed:9819351).Curated1
Sequence conflicti104R → H in CAA04947 (PubMed:9819351).Curated1
Sequence conflicti206H → R in CAA04947 (PubMed:9819351).Curated1
Sequence conflicti394D → N in CAA04947 (PubMed:9819351).Curated1
Sequence conflicti424S → P in CAA04947 (PubMed:9819351).Curated1
Sequence conflicti504S → C in CAA04947 (PubMed:9819351).Curated1
Sequence conflicti573E → D in CAA04947 (PubMed:9819351).Curated1
Sequence conflicti595C → Y in CAA04947 (PubMed:9819351).Curated1
Sequence conflicti694I → M in CAA04947 (PubMed:9819351).Curated1
Sequence conflicti705L → I in CAA04947 (PubMed:9819351).Curated1
Sequence conflicti1591S → P in BAB14517 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_04616537R → K1 PublicationCorresponds to variant dbSNP:rs17855105Ensembl.1
Natural variantiVAR_04616685R → Q1 Publication1
Natural variantiVAR_046167161T → I. Corresponds to variant dbSNP:rs2929516Ensembl.1
Natural variantiVAR_046168168N → D1 Publication1
Natural variantiVAR_046169211L → P1 Publication1
Natural variantiVAR_056189825A → V. Corresponds to variant dbSNP:rs11637562Ensembl.1
Natural variantiVAR_046170946R → Q1 PublicationCorresponds to variant dbSNP:rs754348944Ensembl.1
Natural variantiVAR_0461711193G → E4 PublicationsCorresponds to variant dbSNP:rs2415129Ensembl.1
Natural variantiVAR_0461721362S → P1 PublicationCorresponds to variant dbSNP:rs55738821Ensembl.1
Natural variantiVAR_0461731476P → R. Corresponds to variant dbSNP:rs16956375Ensembl.1
Natural variantiVAR_0461741795H → Y. Corresponds to variant dbSNP:rs16956367Ensembl.1
Natural variantiVAR_0461751805H → Q. Corresponds to variant dbSNP:rs2306575Ensembl.1
Natural variantiVAR_0461761834R → C1 PublicationCorresponds to variant dbSNP:rs74475742Ensembl.1
Natural variantiVAR_0461772390I → V. Corresponds to variant dbSNP:rs2291280Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_03515645 – 280Missing in isoform 5. 1 PublicationAdd BLAST236
Alternative sequenceiVSP_035157367 – 385Missing in isoform 2. CuratedAdd BLAST19
Alternative sequenceiVSP_035158729H → K in isoform 3. 1 Publication1
Alternative sequenceiVSP_035159730 – 2548Missing in isoform 3. 1 PublicationAdd BLAST1819
Alternative sequenceiVSP_0351601714E → EVARPAHKKKARMARTRSDF LTRGTFADGEGDTEEDDYDD IIEPLLSLDQASHCELGPAP SLGQASHSDSEM in isoform 4. 2 Publications1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF117888 mRNA Translation: AAD49195.1
AC020779 Genomic DNA No translation available.
AC022872 Genomic DNA No translation available.
AC090454 Genomic DNA No translation available.
AC104938 Genomic DNA No translation available.
CH471082 Genomic DNA Translation: EAW77880.1
BC060886 mRNA Translation: AAH60886.1
BC140869 mRNA Translation: AAI40870.1
AJ001714 mRNA Translation: CAA04947.1
AB290183 mRNA Translation: BAG06737.1
L29148 mRNA Translation: AAA20911.1
DQ088983 mRNA Translation: AAZ85978.1
DQ088984 mRNA Translation: AAZ85979.1
AL137287 mRNA Translation: CAB70679.1
AK001923 mRNA Translation: BAA91979.1 Different initiation.
AK023306 mRNA Translation: BAB14517.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS10239.1 [B2RTY4-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
E59435
I61699
T46354

NCBI Reference Sequences

More...
RefSeqi
NP_008832.2, NM_006901.3 [B2RTY4-1]
XP_006720602.1, XM_006720539.2 [B2RTY4-4]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.513000
Hs.546268
Hs.733087

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000356056; ENSP00000348349; ENSG00000066933 [B2RTY4-1]
ENST00000424560; ENSP00000399162; ENSG00000066933 [B2RTY4-3]
ENST00000444904; ENSP00000398250; ENSG00000066933 [B2RTY4-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
4649

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:4649

UCSC genome browser

More...
UCSCi
uc002atl.6 human [B2RTY4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF117888 mRNA Translation: AAD49195.1
AC020779 Genomic DNA No translation available.
AC022872 Genomic DNA No translation available.
AC090454 Genomic DNA No translation available.
AC104938 Genomic DNA No translation available.
CH471082 Genomic DNA Translation: EAW77880.1
BC060886 mRNA Translation: AAH60886.1
BC140869 mRNA Translation: AAI40870.1
AJ001714 mRNA Translation: CAA04947.1
AB290183 mRNA Translation: BAG06737.1
L29148 mRNA Translation: AAA20911.1
DQ088983 mRNA Translation: AAZ85978.1
DQ088984 mRNA Translation: AAZ85979.1
AL137287 mRNA Translation: CAB70679.1
AK001923 mRNA Translation: BAA91979.1 Different initiation.
AK023306 mRNA Translation: BAB14517.1 Different initiation.
CCDSiCCDS10239.1 [B2RTY4-1]
PIRiE59435
I61699
T46354
RefSeqiNP_008832.2, NM_006901.3 [B2RTY4-1]
XP_006720602.1, XM_006720539.2 [B2RTY4-4]
UniGeneiHs.513000
Hs.546268
Hs.733087

3D structure databases

ProteinModelPortaliB2RTY4
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110733, 34 interactors
IntActiB2RTY4, 10 interactors
STRINGi9606.ENSP00000348349

PTM databases

iPTMnetiB2RTY4
PhosphoSitePlusiB2RTY4

Polymorphism and mutation databases

BioMutaiMYO9A

Proteomic databases

EPDiB2RTY4
jPOSTiB2RTY4
MaxQBiB2RTY4
PaxDbiB2RTY4
PRIDEiB2RTY4
ProteomicsDBi3450
3451 [B2RTY4-2]
3452 [B2RTY4-3]
3453 [B2RTY4-4]
3454 [B2RTY4-5]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000356056; ENSP00000348349; ENSG00000066933 [B2RTY4-1]
ENST00000424560; ENSP00000399162; ENSG00000066933 [B2RTY4-3]
ENST00000444904; ENSP00000398250; ENSG00000066933 [B2RTY4-1]
GeneIDi4649
KEGGihsa:4649
UCSCiuc002atl.6 human [B2RTY4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
4649
EuPathDBiHostDB:ENSG00000066933.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MYO9A
GeneReviewsiMYO9A

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0012401
HGNCiHGNC:7608 MYO9A
HPAiHPA039812
HPA040071
MalaCardsiMYO9A
MIMi604875 gene
neXtProtiNX_B2RTY4
OpenTargetsiENSG00000066933
Orphaneti98914 Presynaptic congenital myasthenic syndromes
PharmGKBiPA31413

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1453 Eukaryota
KOG4229 Eukaryota
COG5022 LUCA
GeneTreeiENSGT00940000154905
HOVERGENiHBG108165
InParanoidiB2RTY4
KOiK10360
OMAiKPRIGEC
OrthoDBi14881at2759
PhylomeDBiB2RTY4
TreeFamiTF316834

Enzyme and pathway databases

ReactomeiR-HSA-194840 Rho GTPase cycle

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
MYO9A human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
4649

Protein Ontology

More...
PROi
PR:B2RTY4

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000066933 Expressed in 236 organ(s), highest expression level in stomach
ExpressionAtlasiB2RTY4 baseline and differential
GenevisibleiB2RTY4 HS

Family and domain databases

CDDicd00029 C1, 1 hit
cd01385 MYSc_Myo9, 1 hit
Gene3Di1.10.555.10, 1 hit
3.40.850.10, 2 hits
InterProiView protein in InterPro
IPR000048 IQ_motif_EF-hand-BS
IPR036961 Kinesin_motor_dom_sf
IPR028558 MYO9A
IPR001609 Myosin_head_motor_dom
IPR036023 MYSc_Myo9
IPR027417 P-loop_NTPase
IPR002219 PE/DAG-bd
IPR000159 RA_dom
IPR008936 Rho_GTPase_activation_prot
IPR000198 RhoGAP_dom
IPR029071 Ubiquitin-like_domsf
PANTHERiPTHR13140:SF9 PTHR13140:SF9, 2 hits
PfamiView protein in Pfam
PF00612 IQ, 4 hits
PF00063 Myosin_head, 2 hits
PF00788 RA, 1 hit
PF00620 RhoGAP, 1 hit
PRINTSiPR00193 MYOSINHEAVY
SMARTiView protein in SMART
SM00109 C1, 1 hit
SM00015 IQ, 5 hits
SM00242 MYSc, 1 hit
SM00314 RA, 1 hit
SM00324 RhoGAP, 1 hit
SUPFAMiSSF48350 SSF48350, 1 hit
SSF52540 SSF52540, 2 hits
SSF54236 SSF54236, 1 hit
PROSITEiView protein in PROSITE
PS50096 IQ, 4 hits
PS51456 MYOSIN_MOTOR, 1 hit
PS50200 RA, 1 hit
PS50238 RHOGAP, 1 hit
PS00479 ZF_DAG_PE_1, 1 hit
PS50081 ZF_DAG_PE_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMYO9A_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: B2RTY4
Secondary accession number(s): B0I1T5
, C9IYB3, C9JA86, Q14787, Q3YLD7, Q3YLD8, Q6P986, Q9H8T5, Q9NTG2, Q9NUY2, Q9UEP3, Q9UNJ2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 2, 2008
Last sequence update: May 18, 2010
Last modified: February 13, 2019
This is version 110 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again