Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 98 (16 Oct 2019)
Sequence version 1 (08 Apr 2008)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Disks large-associated protein 4

Gene

Dlgap4

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May play a role in the molecular organization of synapses and neuronal cell signaling. Could be an adapter protein linking ion channel to the subsynaptic cytoskeleton. May induce enrichment of PSD-95/SAP90 at the plasma membrane (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-6794361 Neurexins and neuroligins

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Disks large-associated protein 4
Short name:
DAP-4
Alternative name(s):
PSD-95/SAP90-binding protein 4
SAP90/PSD-95-associated protein 4
Short name:
SAPAP-4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Dlgap4
Synonyms:Kiaa0964, Sapap4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2138865 Dlgap4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003450181 – 992Disks large-associated protein 4Add BLAST992

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei206PhosphoserineBy similarity1
Modified residuei207PhosphoserineCombined sources1
Modified residuei290Omega-N-methylarginineCombined sources1
Modified residuei377PhosphoserineCombined sources1
Modified residuei380PhosphoserineBy similarity1
Modified residuei384PhosphoserineCombined sources1
Modified residuei388PhosphoserineCombined sources1
Modified residuei405PhosphoserineCombined sources1
Modified residuei415PhosphoserineCombined sources1
Modified residuei421PhosphoserineCombined sources1
Modified residuei580PhosphoserineCombined sources1
Modified residuei581PhosphoserineCombined sources1
Modified residuei609PhosphoserineCombined sources1
Modified residuei611PhosphoserineCombined sources1
Modified residuei665PhosphoserineCombined sources1
Modified residuei744PhosphoserineCombined sources1
Modified residuei915PhosphothreonineCombined sources1
Modified residuei973PhosphoserineCombined sources1

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
B1AZP2

MaxQB - The MaxQuant DataBase

More...
MaxQBi
B1AZP2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
B1AZP2

PRoteomics IDEntifications database

More...
PRIDEi
B1AZP2

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
B1AZP2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
B1AZP2

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
B1AZP2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000061689 Expressed in 292 organ(s), highest expression level in cochlea

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
B1AZP2 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
B1AZP2 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with DLG1 and DLG4/PSD-95.

By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
230780, 13 interactors

Protein interaction database and analysis system

More...
IntActi
B1AZP2, 13 interactors

Molecular INTeraction database

More...
MINTi
B1AZP2

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000126980

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
B1AZP2

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the SAPAP family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3971 Eukaryota
ENOG4111JKV LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155308

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
B1AZP2

Identification of Orthologs from Complete Genome Data

More...
OMAi
CHQDLAY

Database of Orthologous Groups

More...
OrthoDBi
285447at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
B1AZP2

TreeFam database of animal gene trees

More...
TreeFami
TF321382

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR030527 DLGAP4
IPR005026 SAPAP

The PANTHER Classification System

More...
PANTHERi
PTHR12353 PTHR12353, 1 hit
PTHR12353:SF19 PTHR12353:SF19, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03359 GKAP, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: B1AZP2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKGLGDSRPR HLSDSLDPPH EPLFAGPDRN PYLLSPTEAF AREARFPGQN
60 70 80 90 100
TLPGDGLFPL NNQLPPPSST FPRIHYNSHF EVPEESPFPS HAQATKINRL
110 120 130 140 150
PANLLDQFEK QLPIHRDGFS TLQFPRGEAK ARGESPGRIR HLVHSVQRLF
160 170 180 190 200
FTKAPSMEGT AGKVGGNGSK KGGLEDGKGR RAKSKERAKA GEPKRRSRSN
210 220 230 240 250
ISGWWSSDDN LDGEGGAFRS GPASGLMTLG RQQERTQPRY FMHAYNTISG
260 270 280 290 300
HMLKTTKNTT TELTAPPPPP APPATCPSLG VGTDTNYVKR GSWSTLTLSH
310 320 330 340 350
AHEVCQKTSA TLDKSLLKSK SCHQGLAYHY LQVPGGGGEW STTLLSPRDM
360 370 380 390 400
DSTAEGPIPC RRMRSGSYIK AMGDEDSDES GGGSPKPSPK TAARRQSYLR
410 420 430 440 450
ATQQSLGEQS NPRRSLDRLD SVDMLLPSKC PSWEDDYNPI SDSLNDSSCI
460 470 480 490 500
SQVFGQASLI PQLFGHDQQV READLSDQYE AACESACSEA ESTTAEALDL
510 520 530 540 550
PLPSYFRSRS HSYLRAIQAG CSQEEDSVSL QSLSPPPSTG SLSNSRTLPS
560 570 580 590 600
SSCLVAYKKT PPPVPPRTTS KPFISVTVQS STESAQDTYL DSQDHKSEVT
610 620 630 640 650
SQSGLSNSSD SLDSSTRPPS VTRGGITPGP EAPEPPPKHA ALKSEQGTLT
660 670 680 690 700
SSESHSEAIP KRKLSSIGIQ VDCIQPVPKE EPSPATKFQS IGIQVEDDWR
710 720 730 740 750
SSAPSHSMSS RRDTDSDTQD ANDSSCKSSE RSLPDCTSHP NSISIDAGPR
760 770 780 790 800
QAPKIAQIKR NLSYGDNSDP ALEASSLPPP DPWLETSSSS PAEPAQPGAC
810 820 830 840 850
RRDGYWFLKL LQAETERLEG WCCQMDKETK ENNLSEEVLG KVLSAVGSAQ
860 870 880 890 900
LLMSQKFQQF RGLCEQNLNP DANPRPTAQD LAGFWDLLQL SIEDISMKFD
910 920 930 940 950
ELYHLKANSW QLVETPEKRK EEKKPPPPVP KKPAKSKAAV SRDKASDAGD
960 970 980 990
KQRQEARKRL LAAKRAASVR QNSATESADS IEIYVPEAQT RL
Length:992
Mass (Da):108,037
Last modified:April 8, 2008 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA33016920922ABB9
GO
Isoform 2 (identifier: B1AZP2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     671-700: VDCIQPVPKEEPSPATKFQSIGIQVEDDWR → ERTRRSGSHLSEDNGPKAIDVMAPSSE

Show »
Length:989
Mass (Da):107,551
Checksum:iFC0D22EB3BD0C09F
GO
Isoform 3 (identifier: B1AZP2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-539: Missing.
     540-550: GSLSNSRTLPS → MALCLELLKQC

Show »
Length:453
Mass (Da):49,460
Checksum:iF631D60B5FB7D916
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PUF2E9PUF2_MOUSE
Disks large-associated protein 4
Dlgap4
285Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B7ZNS2B7ZNS2_MOUSE
Disks large-associated protein 4
Dlgap4
975Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6YMR0F6YMR0_MOUSE
Disks large-associated protein 4
Dlgap4
266Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BJW9H3BJW9_MOUSE
Disks large-associated protein 4
Dlgap4
122Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BKJ0H3BKJ0_MOUSE
Disks large-associated protein 4
Dlgap4
68Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I1E4X0I1E4X0_MOUSE
Disks large-associated protein 4
Dlgap4
244Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BL90H3BL90_MOUSE
Disks large-associated protein 4
Dlgap4
42Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BJD4H3BJD4_MOUSE
Disks large-associated protein 4
Dlgap4
109Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC65690 differs from that shown. Intron retention.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti614S → N in AAH24558 (PubMed:15489334).Curated1
Sequence conflicti676Missing in AAO89220 (PubMed:15024750).Curated1
Sequence conflicti689Q → E in AAO89220 (PubMed:15024750).Curated1
Sequence conflicti693I → V in AAO89220 (PubMed:15024750).Curated1
Sequence conflicti693I → V in AAH24558 (PubMed:15489334).Curated1
Sequence conflicti693I → V in AAI06095 (PubMed:15489334).Curated1
Sequence conflicti774A → V in AAH24558 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0349071 – 539Missing in isoform 3. 1 PublicationAdd BLAST539
Alternative sequenceiVSP_034908540 – 550GSLSNSRTLPS → MALCLELLKQC in isoform 3. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_034909671 – 700VDCIQ…EDDWR → ERTRRSGSHLSEDNGPKAID VMAPSSE in isoform 2. 2 PublicationsAdd BLAST30

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK122408 Transcribed RNA Translation: BAC65690.2 Sequence problems.
AY243849 mRNA Translation: AAO89220.2
BX004793 Genomic DNA No translation available.
BX571766 Genomic DNA No translation available.
BC024558 mRNA Translation: AAH24558.1
BC058948 mRNA Translation: AAH58948.1
BC085475 mRNA Translation: AAH85475.1
BC106094 mRNA Translation: AAI06095.1
BC141110 mRNA Translation: AAI41111.1
BC145394 mRNA Translation: AAI45395.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS16968.1 [B1AZP2-1]
CCDS38299.1 [B1AZP2-3]
CCDS71171.1 [B1AZP2-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001035952.1, NM_001042487.1 [B1AZP2-3]
NP_001035953.1, NM_001042488.2
NP_001264115.1, NM_001277186.1 [B1AZP2-2]
NP_001264116.1, NM_001277187.1
NP_666240.4, NM_146128.6 [B1AZP2-1]
XP_006499403.1, XM_006499340.3 [B1AZP2-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000070782; ENSMUSP00000068745; ENSMUSG00000061689 [B1AZP2-2]
ENSMUST00000099145; ENSMUSP00000096749; ENSMUSG00000061689 [B1AZP2-3]
ENSMUST00000109567; ENSMUSP00000105195; ENSMUSG00000061689 [B1AZP2-2]
ENSMUST00000169464; ENSMUSP00000126980; ENSMUSG00000061689 [B1AZP2-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
228836

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:228836

UCSC genome browser

More...
UCSCi
uc008nnr.2 mouse [B1AZP2-1]
uc008nnv.1 mouse [B1AZP2-3]
uc012chv.2 mouse [B1AZP2-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK122408 Transcribed RNA Translation: BAC65690.2 Sequence problems.
AY243849 mRNA Translation: AAO89220.2
BX004793 Genomic DNA No translation available.
BX571766 Genomic DNA No translation available.
BC024558 mRNA Translation: AAH24558.1
BC058948 mRNA Translation: AAH58948.1
BC085475 mRNA Translation: AAH85475.1
BC106094 mRNA Translation: AAI06095.1
BC141110 mRNA Translation: AAI41111.1
BC145394 mRNA Translation: AAI45395.1
CCDSiCCDS16968.1 [B1AZP2-1]
CCDS38299.1 [B1AZP2-3]
CCDS71171.1 [B1AZP2-2]
RefSeqiNP_001035952.1, NM_001042487.1 [B1AZP2-3]
NP_001035953.1, NM_001042488.2
NP_001264115.1, NM_001277186.1 [B1AZP2-2]
NP_001264116.1, NM_001277187.1
NP_666240.4, NM_146128.6 [B1AZP2-1]
XP_006499403.1, XM_006499340.3 [B1AZP2-1]

3D structure databases

SMRiB1AZP2
ModBaseiSearch...

Protein-protein interaction databases

BioGridi230780, 13 interactors
IntActiB1AZP2, 13 interactors
MINTiB1AZP2
STRINGi10090.ENSMUSP00000126980

PTM databases

iPTMnetiB1AZP2
PhosphoSitePlusiB1AZP2
SwissPalmiB1AZP2

Proteomic databases

jPOSTiB1AZP2
MaxQBiB1AZP2
PaxDbiB1AZP2
PRIDEiB1AZP2

Genome annotation databases

EnsembliENSMUST00000070782; ENSMUSP00000068745; ENSMUSG00000061689 [B1AZP2-2]
ENSMUST00000099145; ENSMUSP00000096749; ENSMUSG00000061689 [B1AZP2-3]
ENSMUST00000109567; ENSMUSP00000105195; ENSMUSG00000061689 [B1AZP2-2]
ENSMUST00000169464; ENSMUSP00000126980; ENSMUSG00000061689 [B1AZP2-1]
GeneIDi228836
KEGGimmu:228836
UCSCiuc008nnr.2 mouse [B1AZP2-1]
uc008nnv.1 mouse [B1AZP2-3]
uc012chv.2 mouse [B1AZP2-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
22839
MGIiMGI:2138865 Dlgap4

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiKOG3971 Eukaryota
ENOG4111JKV LUCA
GeneTreeiENSGT00940000155308
InParanoidiB1AZP2
OMAiCHQDLAY
OrthoDBi285447at2759
PhylomeDBiB1AZP2
TreeFamiTF321382

Enzyme and pathway databases

ReactomeiR-MMU-6794361 Neurexins and neuroligins

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Dlgap4 mouse

Protein Ontology

More...
PROi
PR:B1AZP2

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000061689 Expressed in 292 organ(s), highest expression level in cochlea
ExpressionAtlasiB1AZP2 baseline and differential
GenevisibleiB1AZP2 MM

Family and domain databases

InterProiView protein in InterPro
IPR030527 DLGAP4
IPR005026 SAPAP
PANTHERiPTHR12353 PTHR12353, 1 hit
PTHR12353:SF19 PTHR12353:SF19, 1 hit
PfamiView protein in Pfam
PF03359 GKAP, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDLGP4_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: B1AZP2
Secondary accession number(s): B1AZP3
, B7ZNS1, Q3KQQ8, Q6PD44, Q6XBF1, Q80TN3, Q8R3U9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 22, 2008
Last sequence update: April 8, 2008
Last modified: October 16, 2019
This is version 98 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again