Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 107 (08 May 2019)
Sequence version 1 (05 Feb 2008)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

MIF4G domain-containing protein

Gene

MIF4GD

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Functions in replication-dependent translation of histone mRNAs which differ from other eukaryotic mRNAs in that they do not end with a poly-A tail but a stem-loop. May participate in circularizing those mRNAs specifically enhancing their translation.1 Publication

Miscellaneous

Depletion of MIF4GD results in cell death and reduced histone mRNA translation.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processTranslation regulation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
MIF4G domain-containing protein
Alternative name(s):
SLBP-interacting protein 1
Short name:
hSLIP1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MIF4GD
Synonyms:SLIP1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:24030 MIF4GD

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
612072 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_A9UHW6

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
57409

Open Targets

More...
OpenTargetsi
ENSG00000125457

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142671457

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MIF4GD

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003370891 – 222MIF4G domain-containing proteinAdd BLAST222

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
A9UHW6

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
A9UHW6

MaxQB - The MaxQuant DataBase

More...
MaxQBi
A9UHW6

PRoteomics IDEntifications database

More...
PRIDEi
A9UHW6

ProteomicsDB human proteome resource

More...
ProteomicsDBi
2507
2508 [A9UHW6-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
A9UHW6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
A9UHW6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000125457 Expressed in 200 organ(s), highest expression level in quadriceps femoris

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
A9UHW6 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
A9UHW6 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA051222

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with EIF4G1, EIF4G2 and SLBP; probably tethered by SLBP to the 3'-end of mRNAs ending with the histone stem-loop, it also interacts with EIF4G1 which is bound to their 5'-end.1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
121511, 25 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-1313 SLBP-SLIP1 complex

Protein interaction database and analysis system

More...
IntActi
A9UHW6, 27 interactors

Molecular INTeraction database

More...
MINTi
A9UHW6

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
A9UHW6

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini3 – 205MIF4GAdd BLAST203

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the MIF4GD family.Curated

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153432

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231168

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
A9UHW6

Database of Orthologous Groups

More...
OrthoDBi
1168859at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
A9UHW6

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.40.180, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR016024 ARM-type_fold
IPR016021 MIF4-like_sf
IPR003890 MIF4G-like_typ-3

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02854 MIF4G, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00543 MIF4G, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48371 SSF48371, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: A9UHW6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGEPSREEYK IQSFDAETQQ LLKTALKDPG AVDLEKVANV IVDHSLQDCV
60 70 80 90 100
FSKEAGRMCY AIIQAESKQA GQSVFRRGLL NRLQQEYQAR EQLRARSLQG
110 120 130 140 150
WVCYVTFICN IFDYLRVNNM PMMALVNPVY DCLFRLAQPD SLSKEEEVDC
160 170 180 190 200
LVLQLHRVGE QLEKMNGQRM DELFVLIRDG FLLPTGLSSL AQLLLLEIIE
210 220
FRAAGWKTTP AAHKYYYSEV SD
Length:222
Mass (Da):25,423
Last modified:February 5, 2008 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i07E5B651D638AC9D
GO
Isoform 2 (identifier: A9UHW6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     27-27: K → KVACFETEDGEYSVCQRSYSNCSRLMPSRCNTQYR

Show »
Length:256
Mass (Da):29,390
Checksum:iEA6015A7B943B939
GO
Isoform 3 (identifier: A9UHW6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     27-27: K → KAPSLECTVACFETEDGEYSVCQRSYSNCSRLMPSRCNTQYR

Show »
Length:263
Mass (Da):30,091
Checksum:i1FA6F7F214E4BACA
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3QLJ5J3QLJ5_HUMAN
MIF4G domain-containing protein
MIF4GD
251Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QRZ6J3QRZ6_HUMAN
MIF4G domain-containing protein
MIF4GD
204Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KSB8J3KSB8_HUMAN
MIF4G domain containing isoform 4
MIF4GD
170Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QLD1J3QLD1_HUMAN
MIF4G domain-containing protein
MIF4GD
90Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KSU6J3KSU6_HUMAN
MIF4G domain-containing protein
MIF4GD
155Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3B3IU65A0A3B3IU65_HUMAN
MIF4G domain-containing protein
MIF4GD
277Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QLN4J3QLN4_HUMAN
MIF4G domain-containing protein
MIF4GD
41Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QKW3J3QKW3_HUMAN
MIF4G domain-containing protein
MIF4GD
169Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAG09724 differs from that shown. Reason: Frameshift at several positions.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_03387727K → KVACFETEDGEYSVCQRSYS NCSRLMPSRCNTQYR in isoform 2. 1 Publication1
Alternative sequenceiVSP_04740827K → KAPSLECTVACFETEDGEYS VCQRSYSNCSRLMPSRCNTQ YR in isoform 3. 2 Publications1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
EU287989 mRNA Translation: ABX83907.1
AL555095 mRNA No translation available.
AK300711 mRNA Translation: BAG62389.1
AC022211 Genomic DNA No translation available.
CH471099 Genomic DNA Translation: EAW89263.1
BC033759 mRNA Translation: AAH33759.1
AF225422 mRNA Translation: AAG09724.1 Frameshift.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS11719.1 [A9UHW6-2]
CCDS56044.1 [A9UHW6-1]
CCDS58598.1 [A9UHW6-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001229427.1, NM_001242498.1 [A9UHW6-3]
NP_001229429.1, NM_001242500.1 [A9UHW6-2]
NP_001229430.1, NM_001242501.1 [A9UHW6-1]
NP_065730.2, NM_020679.3 [A9UHW6-2]
XP_005257587.1, XM_005257530.1
XP_005257589.1, XM_005257532.4 [A9UHW6-1]
XP_005257590.1, XM_005257533.1
XP_016880382.1, XM_017024893.1
XP_016880383.1, XM_017024894.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000245551; ENSP00000245551; ENSG00000125457 [A9UHW6-2]
ENST00000325102; ENSP00000321625; ENSG00000125457 [A9UHW6-1]
ENST00000577542; ENSP00000463334; ENSG00000125457 [A9UHW6-3]
ENST00000579297; ENSP00000462459; ENSG00000125457 [A9UHW6-3]
ENST00000618645; ENSP00000484245; ENSG00000125457 [A9UHW6-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
57409

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:57409

UCSC genome browser

More...
UCSCi
uc002jnp.5 human [A9UHW6-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
EU287989 mRNA Translation: ABX83907.1
AL555095 mRNA No translation available.
AK300711 mRNA Translation: BAG62389.1
AC022211 Genomic DNA No translation available.
CH471099 Genomic DNA Translation: EAW89263.1
BC033759 mRNA Translation: AAH33759.1
AF225422 mRNA Translation: AAG09724.1 Frameshift.
CCDSiCCDS11719.1 [A9UHW6-2]
CCDS56044.1 [A9UHW6-1]
CCDS58598.1 [A9UHW6-3]
RefSeqiNP_001229427.1, NM_001242498.1 [A9UHW6-3]
NP_001229429.1, NM_001242500.1 [A9UHW6-2]
NP_001229430.1, NM_001242501.1 [A9UHW6-1]
NP_065730.2, NM_020679.3 [A9UHW6-2]
XP_005257587.1, XM_005257530.1
XP_005257589.1, XM_005257532.4 [A9UHW6-1]
XP_005257590.1, XM_005257533.1
XP_016880382.1, XM_017024893.1
XP_016880383.1, XM_017024894.1

3D structure databases

SMRiA9UHW6
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121511, 25 interactors
ComplexPortaliCPX-1313 SLBP-SLIP1 complex
IntActiA9UHW6, 27 interactors
MINTiA9UHW6

PTM databases

iPTMnetiA9UHW6
PhosphoSitePlusiA9UHW6

Polymorphism and mutation databases

BioMutaiMIF4GD

Proteomic databases

EPDiA9UHW6
jPOSTiA9UHW6
MaxQBiA9UHW6
PRIDEiA9UHW6
ProteomicsDBi2507
2508 [A9UHW6-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
57409
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000245551; ENSP00000245551; ENSG00000125457 [A9UHW6-2]
ENST00000325102; ENSP00000321625; ENSG00000125457 [A9UHW6-1]
ENST00000577542; ENSP00000463334; ENSG00000125457 [A9UHW6-3]
ENST00000579297; ENSP00000462459; ENSG00000125457 [A9UHW6-3]
ENST00000618645; ENSP00000484245; ENSG00000125457 [A9UHW6-1]
GeneIDi57409
KEGGihsa:57409
UCSCiuc002jnp.5 human [A9UHW6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
57409
DisGeNETi57409

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MIF4GD

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0202398
HGNCiHGNC:24030 MIF4GD
HPAiHPA051222
MIMi612072 gene
neXtProtiNX_A9UHW6
OpenTargetsiENSG00000125457
PharmGKBiPA142671457

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00940000153432
HOGENOMiHOG000231168
InParanoidiA9UHW6
OrthoDBi1168859at2759
PhylomeDBiA9UHW6

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
MIF4GD human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
57409

Protein Ontology

More...
PROi
PR:A9UHW6

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000125457 Expressed in 200 organ(s), highest expression level in quadriceps femoris
ExpressionAtlasiA9UHW6 baseline and differential
GenevisibleiA9UHW6 HS

Family and domain databases

Gene3Di1.25.40.180, 1 hit
InterProiView protein in InterPro
IPR016024 ARM-type_fold
IPR016021 MIF4-like_sf
IPR003890 MIF4G-like_typ-3
PfamiView protein in Pfam
PF02854 MIF4G, 1 hit
SMARTiView protein in SMART
SM00543 MIF4G, 1 hit
SUPFAMiSSF48371 SSF48371, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMI4GD_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A9UHW6
Secondary accession number(s): B4DUM7, Q8N4Q5, Q9HBL5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: February 5, 2008
Last modified: May 8, 2019
This is version 107 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again