Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 69 (08 May 2019)
Sequence version 1 (04 Dec 2007)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Outer dense fiber protein 3B

Gene

ODF3B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Outer dense fiber protein 3B
Alternative name(s):
Outer dense fiber protein 3-like protein 3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ODF3B
Synonyms:ODF3L3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 22

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:34388 ODF3B

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_A8MYP8

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
440836

Open Targets

More...
OpenTargetsi
ENSG00000177989

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162398386

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ODF3B

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003464401 – 253Outer dense fiber protein 3BAdd BLAST253

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
A8MYP8

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
A8MYP8

PRoteomics IDEntifications database

More...
PRIDEi
A8MYP8

ProteomicsDB human proteome resource

More...
ProteomicsDBi
2415
2416 [A8MYP8-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
A8MYP8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
A8MYP8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000177989 Expressed in 145 organ(s), highest expression level in right uterine tube

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
A8MYP8 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
A8MYP8 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA062837

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
A8MYP8, 11 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000382804

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati182 – 207STPGRAdd BLAST26

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the ODF3 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IPQP Eukaryota
ENOG411182I LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000161995

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000090412

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
A8MYP8

Database of Orthologous Groups

More...
OrthoDBi
920847at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
A8MYP8

TreeFam database of animal gene trees

More...
TreeFami
TF325804

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR010736 SHIPPO-rpt

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07004 SHIPPO-rpt, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: A8MYP8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGSDAWVGLW RPHRPRGPIA AHYGGPGPKY KLPPNTGYAL HDPSRPRAPA
60 70 80 90 100
FTFGARFPTQ QTTCGPGPGH LVPARMTVRG TDGAPAYSIY GRPRRSAPFL
110 120 130 140 150
TPGPGRYFPE RAGNATYPSA PRHTIAPRNW GVQAEQQSPG PAAYTVPSLL
160 170 180 190 200
GPRVIGKVSA PTCSIYGRRA AGSFFEDLSK TPGPCAYQVV SPGVYKSRAP
210 220 230 240 250
QFTILARTSL PQDNTRKPGP AAYNVDQHRK PRGWSFGIRH SDYLAPLVTD

ADN
Note: Gene prediction based on EST data.
Length:253
Mass (Da):27,280
Last modified:December 4, 2007 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iAB7BCC87C5347B5A
GO
Isoform 2 (identifier: A8MYP8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MGSDAWVGLWRPHRPRGPIAAHYGGPGPKYKLPPNT → MGLGAGPGQTLTRMLP
     106-129: RYFPERAGNATYPSAPRHTIAPRN → QDPRAPGHPNAELPPGRPTWEPPT
     130-253: Missing.

Note: No experimental confirmation available.
Show »
Length:109
Mass (Da):11,447
Checksum:i79692E9C77DDFDF4
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B5MCN9B5MCN9_HUMAN
Outer dense fiber protein 3B
ODF3B
281Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B5MC17B5MC17_HUMAN
Outer dense fiber protein 3B
ODF3B
185Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JUR5C9JUR5_HUMAN
Outer dense fiber protein 3B
ODF3B
46Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B5MD02B5MD02_HUMAN
Outer dense fiber protein 3B
ODF3B
242Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0349951 – 36MGSDA…LPPNT → MGLGAGPGQTLTRMLP in isoform 2. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_034996106 – 129RYFPE…IAPRN → QDPRAPGHPNAELPPGRPTW EPPT in isoform 2. 1 PublicationAdd BLAST24
Alternative sequenceiVSP_034997130 – 253Missing in isoform 2. 1 PublicationAdd BLAST124

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U62317 Genomic DNA No translation available.
BC127934 mRNA Translation: AAI27935.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS43039.1 [A8MYP8-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001014440.2, NM_001014440.3 [A8MYP8-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000329363; ENSP00000382804; ENSG00000177989 [A8MYP8-1]
ENST00000428989; ENSP00000390712; ENSG00000177989 [A8MYP8-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
440836

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:440836

UCSC genome browser

More...
UCSCi
uc003bmh.2 human [A8MYP8-1]

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U62317 Genomic DNA No translation available.
BC127934 mRNA Translation: AAI27935.1
CCDSiCCDS43039.1 [A8MYP8-1]
RefSeqiNP_001014440.2, NM_001014440.3 [A8MYP8-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

IntActiA8MYP8, 11 interactors
STRINGi9606.ENSP00000382804

PTM databases

iPTMnetiA8MYP8
PhosphoSitePlusiA8MYP8

Polymorphism and mutation databases

BioMutaiODF3B

Proteomic databases

EPDiA8MYP8
PaxDbiA8MYP8
PRIDEiA8MYP8
ProteomicsDBi2415
2416 [A8MYP8-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
440836
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000329363; ENSP00000382804; ENSG00000177989 [A8MYP8-1]
ENST00000428989; ENSP00000390712; ENSG00000177989 [A8MYP8-1]
GeneIDi440836
KEGGihsa:440836
UCSCiuc003bmh.2 human [A8MYP8-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
440836
DisGeNETi440836

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ODF3B
HGNCiHGNC:34388 ODF3B
HPAiHPA062837
neXtProtiNX_A8MYP8
OpenTargetsiENSG00000177989
PharmGKBiPA162398386

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IPQP Eukaryota
ENOG411182I LUCA
GeneTreeiENSGT00940000161995
HOGENOMiHOG000090412
InParanoidiA8MYP8
OrthoDBi920847at2759
PhylomeDBiA8MYP8
TreeFamiTF325804

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ODF3B human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
440836

Protein Ontology

More...
PROi
PR:A8MYP8

Gene expression databases

BgeeiENSG00000177989 Expressed in 145 organ(s), highest expression level in right uterine tube
ExpressionAtlasiA8MYP8 baseline and differential
GenevisibleiA8MYP8 HS

Family and domain databases

InterProiView protein in InterPro
IPR010736 SHIPPO-rpt
PfamiView protein in Pfam
PF07004 SHIPPO-rpt, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiODF3B_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A8MYP8
Secondary accession number(s): A0PK18
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 2, 2008
Last sequence update: December 4, 2007
Last modified: May 8, 2019
This is version 69 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again