Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 80 (08 May 2019)
Sequence version 2 (13 Jul 2010)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Rho guanine nucleotide exchange factor 33

Gene

ARHGEF33

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May act as a guanine-nucleotide releasing factor.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGuanine-nucleotide releasing factor

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-193648 NRAGE signals death through JNK
R-HSA-194840 Rho GTPase cycle
R-HSA-416482 G alpha (12/13) signalling events

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Rho guanine nucleotide exchange factor 33
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:37252 ARHGEF33

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_A8MVX0

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ARHGEF33

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003423431 – 844Rho guanine nucleotide exchange factor 33Add BLAST844

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei757Omega-N-methylarginineBy similarity1

Keywords - PTMi

Methylation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
A8MVX0

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
A8MVX0

PRoteomics IDEntifications database

More...
PRIDEi
A8MVX0

ProteomicsDB human proteome resource

More...
ProteomicsDBi
2212

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
A8MVX0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
A8MVX0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000214694 Expressed in 86 organ(s), highest expression level in right hemisphere of cerebellum

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
A8MVX0 baseline and differential

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA034661
HPA041051

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
938496, 3 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000387020

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
A8MVX0

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini265 – 440DHPROSITE-ProRule annotationAdd BLAST176

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili54 – 129Sequence analysisAdd BLAST76

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi522 – 525Poly-Gln4
Compositional biasi750 – 756Poly-Ala7

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IJAS Eukaryota
ENOG4111MU9 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000162759

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000168823

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
A8MVX0

Identification of Orthologs from Complete Genome Data

More...
OMAi
DIAFVKC

Database of Orthologous Groups

More...
OrthoDBi
229670at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
A8MVX0

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.900.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR035899 DBL_dom_sf
IPR000219 DH-domain

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00621 RhoGEF, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00325 RhoGEF, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48065 SSF48065, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50010 DH_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: A8MVX0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEKTKTKQGE NEHMPVNNPS TQIYQLQALA SELKTGFTEA MQELSRIQHG
60 70 80 90 100
EYALEEKVKS CRCSMEEKVT EMKNSLNYFK EELSNAMSMI QAITSKQEEM
110 120 130 140 150
QQKIEQLQQE KRRESRKVKA KKTQKEEHSS QAGPAQAQGS PFRSINIPEP
160 170 180 190 200
VLPSEDFTNL LPSQAYEKAQ ESRSVHVGDS NVKGMMGPGV NPTTPEAEEN
210 220 230 240 250
LKSCLSADIQ SKGHLPSGMW RQPKDGKEWG EEYVTKDHPD KLKEAGQGRH
260 270 280 290 300
SSLENVLCET SLAAKRQTVA LELLESERKY VINISLILKI KATFQGSDGK
310 320 330 340 350
RNSKERSLFP GSLRYLVQQH LDLLHALQER VLKWPRQGVL GDLFLKLTND
360 370 380 390 400
ENNFLDYYVA YLRDLPECIS LVHVVVLKEG DEEIKSDIYT LFFHIVQRIP
410 420 430 440 450
EYLIHLQNVL KFTEQEHPDY YLLLVCVQRL RVFISHYTLL FQCNEDLLIQ
460 470 480 490 500
KRKKLKKSSM AKLYKGLASQ CANAGQDASP TAGPEAVRDT GIHSEELLQP
510 520 530 540 550
YPSAPSSGPA ITHLMPPVKK SQQQQSLMES MQPGKPSDWE LEGRKHERPE
560 570 580 590 600
SLLAPTQFCA AEQDVKALAG PLQAIPEMDF ESSPAEPLGN VERSLRAPAE
610 620 630 640 650
LLPDARGFVP AAYEEFEYGG EIFALPAPYD EEPFQAPALF ENCSPASSES
660 670 680 690 700
SLDICFLRPV SFAMEAERPE HPLQPLPKSA TSPAGSSSAY KLEAAAQAHG
710 720 730 740 750
KAKPLSRSLK EFPRAPPADG VAPRLYSTRS SSGGRAPIKA ERAAQAHGPA
760 770 780 790 800
AAAVAARGAS RTFFPQQRSQ SEKQTYLEVR REMHLEDTTR FCPKEERESE
810 820 830 840
QTSFSDQNPR QDQKGGFRSS FRKLFKKKNG NATGEDFCGP WGWW
Length:844
Mass (Da):94,633
Last modified:July 13, 2010 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i790FB919145D5C3E
GO
Isoform 2 (identifier: A8MVX0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     829-844: NGNATGEDFCGPWGWW → SSGSEYREKTNENPSMDPSPTKQDFFRNRLALANDLDQGTAV

Note: No experimental confirmation available.
Show »
Length:870
Mass (Da):97,524
Checksum:i9EA51122954F91BB
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7C1C9H7C1C9_HUMAN
Rho guanine nucleotide exchange fac...
ARHGEF33
62Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence DV080278 differs from that shown. Reason: Frameshift at position 79.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_044905829 – 844NGNAT…PWGWW → SSGSEYREKTNENPSMDPSP TKQDFFRNRLALANDLDQGT AV in isoform 2. 1 PublicationAdd BLAST16

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AC018693 Genomic DNA No translation available.
AC019171 Genomic DNA No translation available.
DV080278 mRNA No translation available.
AK123375 mRNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS46263.2 [A8MVX0-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001138923.2, NM_001145451.2 [A8MVX0-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000398800; ENSP00000381780; ENSG00000214694 [A8MVX0-2]
ENST00000409978; ENSP00000387020; ENSG00000214694 [A8MVX0-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
100271715

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:100271715

UCSC genome browser

More...
UCSCi
uc021vgd.2 human [A8MVX0-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC018693 Genomic DNA No translation available.
AC019171 Genomic DNA No translation available.
DV080278 mRNA No translation available.
AK123375 mRNA No translation available.
CCDSiCCDS46263.2 [A8MVX0-2]
RefSeqiNP_001138923.2, NM_001145451.2 [A8MVX0-2]

3D structure databases

SMRiA8MVX0
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi938496, 3 interactors
STRINGi9606.ENSP00000387020

PTM databases

iPTMnetiA8MVX0
PhosphoSitePlusiA8MVX0

Polymorphism and mutation databases

BioMutaiARHGEF33

Proteomic databases

EPDiA8MVX0
PaxDbiA8MVX0
PRIDEiA8MVX0
ProteomicsDBi2212

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000398800; ENSP00000381780; ENSG00000214694 [A8MVX0-2]
ENST00000409978; ENSP00000387020; ENSG00000214694 [A8MVX0-2]
GeneIDi100271715
KEGGihsa:100271715
UCSCiuc021vgd.2 human [A8MVX0-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
100271715

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ARHGEF33
HGNCiHGNC:37252 ARHGEF33
HPAiHPA034661
HPA041051
neXtProtiNX_A8MVX0

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IJAS Eukaryota
ENOG4111MU9 LUCA
GeneTreeiENSGT00940000162759
HOGENOMiHOG000168823
InParanoidiA8MVX0
OMAiDIAFVKC
OrthoDBi229670at2759
PhylomeDBiA8MVX0

Enzyme and pathway databases

ReactomeiR-HSA-193648 NRAGE signals death through JNK
R-HSA-194840 Rho GTPase cycle
R-HSA-416482 G alpha (12/13) signalling events

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
100271715

Protein Ontology

More...
PROi
PR:A8MVX0

Gene expression databases

BgeeiENSG00000214694 Expressed in 86 organ(s), highest expression level in right hemisphere of cerebellum
ExpressionAtlasiA8MVX0 baseline and differential

Family and domain databases

Gene3Di1.20.900.10, 1 hit
InterProiView protein in InterPro
IPR035899 DBL_dom_sf
IPR000219 DH-domain
PfamiView protein in Pfam
PF00621 RhoGEF, 1 hit
SMARTiView protein in SMART
SM00325 RhoGEF, 1 hit
SUPFAMiSSF48065 SSF48065, 1 hit
PROSITEiView protein in PROSITE
PS50010 DH_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiARG33_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A8MVX0
Secondary accession number(s): J3KPX2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 1, 2008
Last sequence update: July 13, 2010
Last modified: May 8, 2019
This is version 80 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again