Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 88 (13 Feb 2019)
Sequence version 3 (14 Oct 2008)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Zinc finger B-box domain-containing protein 1

Gene

ZBBX

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri129 – 175B box-type; atypicalAdd BLAST47

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Zinc finger B-box domain-containing protein 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ZBBX
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000169064.12

Human Gene Nomenclature Database

More...
HGNCi
HGNC:26245 ZBBX

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_A8MT70

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
79740

Open Targets

More...
OpenTargetsi
ENSG00000169064

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162409400

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ZBBX

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003258131 – 800Zinc finger B-box domain-containing protein 1Add BLAST800

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
A8MT70

PRoteomics IDEntifications database

More...
PRIDEi
A8MT70

ProteomicsDB human proteome resource

More...
ProteomicsDBi
2001
2002 [A8MT70-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
A8MT70

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
A8MT70

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000169064 Expressed in 93 organ(s), highest expression level in bronchial epithelial cell

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
A8MT70 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
A8MT70 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA036327
HPA036328

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
122853, 29 interactors

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
A8MT70

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili21 – 64Sequence analysisAdd BLAST44
Coiled coili693 – 720Sequence analysisAdd BLAST28

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi641 – 674Ser-richAdd BLAST34
Compositional biasi780 – 783Poly-Glu4

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri129 – 175B box-type; atypicalAdd BLAST47

Keywords - Domaini

Coiled coil, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IVIG Eukaryota
ENOG4111KT9 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000018298

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000136319

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG106618

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
A8MT70

Identification of Orthologs from Complete Genome Data

More...
OMAi
WIPDHSL

Database of Orthologous Groups

More...
OrthoDBi
242112at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
A8MT70

TreeFam database of animal gene trees

More...
TreeFami
TF337517

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR037688 ZBBX
IPR000315 Znf_B-box

The PANTHER Classification System

More...
PANTHERi
PTHR28634 PTHR28634, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00643 zf-B_box, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: A8MT70-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNRKDFVVLP WGKPGNSVKL KYRNAQELRM EKVQLEFENQ EMEKKLQEFR
60 70 80 90 100
STRNKEKEDR ESSEYYWKSG KVGKLVNQSY MMSQNKGNVV KFSAGKVKLK
110 120 130 140 150
LLKEQIQEPV KPTVNYKMAN SSECEKPKIN GKVCGQCENK AALLVCLECG
160 170 180 190 200
EDYCSGCFAK VHQKGALKLH RTTLLQAKSQ ILFNVLDVAH QFIKDVNPDE
210 220 230 240 250
PKEENNSTKE TSKIQHKPKS VLLQRSSSEV EITTMKRAQR TKPRKSLLCE
260 270 280 290 300
GSFDEEASAQ SFQEVLSQWR TGNHDDNKKQ NLHAAVKDSL EECEVQTNLK
310 320 330 340 350
IWREPLNIEL KEDILSYMEK LWLKKHRRTP QEQLFKMLPD TFPHPHETTG
360 370 380 390 400
DAQCSQNEND EDSDGEETKV QHTALLLPVE TLNIERPEPS LKIVELDDTY
410 420 430 440 450
EEEFEEAENI VPYKVKLADA DSQRSCAFHD CQKNSFPYEN GIHQHHVFDK
460 470 480 490 500
GKRDFLNLCL RNSSTYYKDN SKAETSNTDF DNIVDPDVYS SDIEKIEEST
510 520 530 540 550
SFERNLKEKN IGLESNQKSD DSCVSLESKD TLLGRDLEKA PIEEKLSQDI
560 570 580 590 600
KESLELSNLY KRPSFEESKT TKSSLLLQEI ACRSKPITKQ YQGLERFFIF
610 620 630 640 650
DTNERLNLLP SHRLECNNSS TRITLAGQKS QRPSTANFPL SNSVKESSSC
660 670 680 690 700
LSSSHPRSRS AAAQSSSRAA SEISEIEYID ITDQNELSLD DTTDQHTLDN
710 720 730 740 750
LEKELQVLRS LADTSEKLYS LTSEEFPDFS SQSLNISQIS TDFLKTSHVR
760 770 780 790 800
GPCGVEELSC SGRDTKIQSL LSLSESSTDE EEEDFLNKQH VITLPWSKST
Note: No experimental confirmation available.
Length:800
Mass (Da):91,426
Last modified:October 14, 2008 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD008D3C3D4DE00C3
GO
Isoform 3 (identifier: A8MT70-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-29: Missing.

Note: No experimental confirmation available.
Show »
Length:771
Mass (Da):87,999
Checksum:iDA50F4C1E52A1733
GO
Isoform 2 (identifier: A8MT70-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     626-626: A → AEDREWIPDHSLSEYADNAIVLGVLQGAQSPSSSRKQQKM

Note: No experimental confirmation available.
Show »
Length:839
Mass (Da):95,780
Checksum:i2D736A0DA7314002
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JVV2C9JVV2_HUMAN
Zinc finger B-box domain-containing...
ZBBX
163Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J608C9J608_HUMAN
Zinc finger B-box domain-containing...
ZBBX
68Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C534H7C534_HUMAN
Zinc finger B-box domain-containing...
ZBBX
86Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C590H7C590_HUMAN
Zinc finger B-box domain-containing...
ZBBX
49Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C4M7H7C4M7_HUMAN
Zinc finger B-box domain-containing...
ZBBX
45Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB15532 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti273N → K in BAB15532 (PubMed:14702039).Curated1
Sequence conflicti339P → S in BAB15532 (PubMed:14702039).Curated1
Sequence conflicti576L → S in BAG52683 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_04840014P → T. Corresponds to variant dbSNP:rs10936535Ensembl.1
Natural variantiVAR_048401160K → N. Corresponds to variant dbSNP:rs4619784Ensembl.1
Natural variantiVAR_048402178K → R. Corresponds to variant dbSNP:rs11923054Ensembl.1
Natural variantiVAR_061040346H → R. Corresponds to variant dbSNP:rs34465133Ensembl.1
Natural variantiVAR_048403473A → G1 PublicationCorresponds to variant dbSNP:rs13096767Ensembl.1
Natural variantiVAR_048404511I → T. Corresponds to variant dbSNP:rs35190925Ensembl.1
Natural variantiVAR_048405555E → K. Corresponds to variant dbSNP:rs35864545Ensembl.1
Natural variantiVAR_046955636A → G1 PublicationCorresponds to variant dbSNP:rs12638625Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0548511 – 29Missing in isoform 3. CuratedAdd BLAST29
Alternative sequenceiVSP_035573626A → AEDREWIPDHSLSEYADNAI VLGVLQGAQSPSSSRKQQKM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AC107311 Genomic DNA No translation available.
AC117463 Genomic DNA No translation available.
AK026702 mRNA Translation: BAB15532.1 Different initiation.
AK093296 mRNA Translation: BAG52683.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS3199.2 [A8MT70-1]
CCDS56295.1 [A8MT70-3]
CCDS56296.1 [A8MT70-2]

NCBI Reference Sequences

More...
RefSeqi
NP_078963.2, NM_024687.3 [A8MT70-1]
XP_016862678.1, XM_017007189.1 [A8MT70-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.478143

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000307529; ENSP00000305065; ENSG00000169064 [A8MT70-2]
ENST00000392764; ENSP00000376517; ENSG00000169064 [A8MT70-3]
ENST00000392766; ENSP00000376519; ENSG00000169064 [A8MT70-1]
ENST00000392767; ENSP00000376520; ENSG00000169064 [A8MT70-3]
ENST00000455345; ENSP00000390232; ENSG00000169064 [A8MT70-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
79740

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:79740

UCSC genome browser

More...
UCSCi
uc003fep.4 human [A8MT70-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC107311 Genomic DNA No translation available.
AC117463 Genomic DNA No translation available.
AK026702 mRNA Translation: BAB15532.1 Different initiation.
AK093296 mRNA Translation: BAG52683.1
CCDSiCCDS3199.2 [A8MT70-1]
CCDS56295.1 [A8MT70-3]
CCDS56296.1 [A8MT70-2]
RefSeqiNP_078963.2, NM_024687.3 [A8MT70-1]
XP_016862678.1, XM_017007189.1 [A8MT70-1]
UniGeneiHs.478143

3D structure databases

ProteinModelPortaliA8MT70
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122853, 29 interactors

PTM databases

iPTMnetiA8MT70
PhosphoSitePlusiA8MT70

Polymorphism and mutation databases

BioMutaiZBBX

Proteomic databases

PaxDbiA8MT70
PRIDEiA8MT70
ProteomicsDBi2001
2002 [A8MT70-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000307529; ENSP00000305065; ENSG00000169064 [A8MT70-2]
ENST00000392764; ENSP00000376517; ENSG00000169064 [A8MT70-3]
ENST00000392766; ENSP00000376519; ENSG00000169064 [A8MT70-1]
ENST00000392767; ENSP00000376520; ENSG00000169064 [A8MT70-3]
ENST00000455345; ENSP00000390232; ENSG00000169064 [A8MT70-2]
GeneIDi79740
KEGGihsa:79740
UCSCiuc003fep.4 human [A8MT70-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
79740
DisGeNETi79740
EuPathDBiHostDB:ENSG00000169064.12

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ZBBX
HGNCiHGNC:26245 ZBBX
HPAiHPA036327
HPA036328
neXtProtiNX_A8MT70
OpenTargetsiENSG00000169064
PharmGKBiPA162409400

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IVIG Eukaryota
ENOG4111KT9 LUCA
GeneTreeiENSGT00390000018298
HOGENOMiHOG000136319
HOVERGENiHBG106618
InParanoidiA8MT70
OMAiWIPDHSL
OrthoDBi242112at2759
PhylomeDBiA8MT70
TreeFamiTF337517

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
79740

Protein Ontology

More...
PROi
PR:A8MT70

Gene expression databases

BgeeiENSG00000169064 Expressed in 93 organ(s), highest expression level in bronchial epithelial cell
ExpressionAtlasiA8MT70 baseline and differential
GenevisibleiA8MT70 HS

Family and domain databases

InterProiView protein in InterPro
IPR037688 ZBBX
IPR000315 Znf_B-box
PANTHERiPTHR28634 PTHR28634, 1 hit
PfamiView protein in Pfam
PF00643 zf-B_box, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZBBX_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A8MT70
Secondary accession number(s): A8MV69
, B3KSC1, B5MDJ6, F2Z370, Q9H5T8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: October 14, 2008
Last modified: February 13, 2019
This is version 88 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again