Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 99 (08 May 2019)
Sequence version 2 (10 Jun 2008)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

ERI1 exoribonuclease 2

Gene

ERI2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mg2+By similarityNote: Binds 2 magnesium ions per subunit.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi41Magnesium 1By similarity1
Metal bindingi41Magnesium 2By similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei43Proton acceptorSequence analysis1
Metal bindingi43Magnesium 1By similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei43AMPBy similarity1
Metal bindingi156Magnesium 2By similarity1
Active sitei213Proton acceptorSequence analysis1
Binding sitei213AMPBy similarity1
Metal bindingi218Magnesium 1By similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionExonuclease, Hydrolase, Nuclease
LigandMagnesium, Metal-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
ERI1 exoribonuclease 2 (EC:3.1.-.-)
Alternative name(s):
Exonuclease domain-containing protein 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ERI2
Synonyms:EXOD1, KIAA1504
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:30541 ERI2

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_A8K979

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
112479

Open Targets

More...
OpenTargetsi
ENSG00000196678

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA164719245

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ERI2

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003389731 – 691ERI1 exoribonuclease 2Add BLAST691

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
A8K979

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
A8K979

MaxQB - The MaxQuant DataBase

More...
MaxQBi
A8K979

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
A8K979

PRoteomics IDEntifications database

More...
PRIDEi
A8K979

ProteomicsDB human proteome resource

More...
ProteomicsDBi
1893
1894 [A8K979-2]
1895 [A8K979-3]
1896 [A8K979-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
A8K979

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
A8K979

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000196678 Expressed in 213 organ(s), highest expression level in endometrium

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
A8K979 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
A8K979 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA035384
HPA035385

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
125189, 2 interactors

Protein interaction database and analysis system

More...
IntActi
A8K979, 3 interactors

Molecular INTeraction database

More...
MINTi
A8K979

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000350651

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini37 – 226ExonucleaseAdd BLAST190

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the ERI2 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0542 Eukaryota
COG5018 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00530000063205

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000112417

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
A8K979

KEGG Orthology (KO)

More...
KOi
K18417

Identification of Orthologs from Complete Genome Data

More...
OMAi
CRELTHI

Database of Orthologous Groups

More...
OrthoDBi
809000at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
A8K979

TreeFam database of animal gene trees

More...
TreeFami
TF313449

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.420.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013520 Exonuclease_RNaseT/DNA_pol3
IPR012337 RNaseH-like_sf
IPR036397 RNaseH_sf
IPR010666 Znf_GRF

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00929 RNase_T, 1 hit
PF06839 zf-GRF, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00479 EXOIII, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF53098 SSF53098, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: A8K979-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MATKRLARQL GLIRRKSIAP ANGNLGRSKS KQLFDYLIVI DFESTCWNDG
60 70 80 90 100
KHHHSQEIIE FPAVLLNTST GQIDSEFQAY VQPQEHPILS EFCMELTGIK
110 120 130 140 150
QAQVDEGVPL KICLSQFCKW IHKIQQQKNI IFATGISEPS ASEVKLCAFV
160 170 180 190 200
TWSDWDLGVC LEYECKRKQL LKPVFLNSWI DLRATYKLFY RRKPKGLSGA
210 220 230 240 250
LQEVGIEFSG REHSGLDDSR NTALLAWKMI RDGCVMKITR SLNKVPTKKN
260 270 280 290 300
FSILARNLNT IQVEEMSACN ISIQGPSIYN KEPKNIINPH EKVQMKSICA
310 320 330 340 350
NSPIKAQQDQ LQVKNNIKAS LHNVKSSLPL FNTKSSTSVG QLQSPTLNSP
360 370 380 390 400
IYMQKQGKNE HLAFNTKSKA STVGSELVLV STTVPTVHHV SDLEMSSTLD
410 420 430 440 450
CLPVLADWED VVLLPASQPE ENVDCTVPIS DSDLEISFNS GERLMVLKEL
460 470 480 490 500
EMSSHENFGD IEETPQKSET SKSIVYKSPH TTIYNVKEAK DPGSDISAFK
510 520 530 540 550
LPEHKSSTFN RVNANMSHPL VLGKHPLLSG GTKRNPCSPQ AFPPAKKQPF
560 570 580 590 600
TIHEEKPTSS DCSPVRSSSW RRLPSILTST VNLQEPWKSG KMTPPLCKCG
610 620 630 640 650
RRSKRLVVSN NGPNHGKVFY CCPIGKYQEN RKCCGYFKWE QTLQKERANS
660 670 680 690
MVPSHSTGGL TFSSPETSHI CDRNLSISTK NSLRLRPSMR N
Length:691
Mass (Da):77,401
Last modified:June 10, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3A0DA36ABDDAA36D
GO
Isoform 2 (identifier: A8K979-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-93: Missing.

Show »
Length:598
Mass (Da):66,834
Checksum:i5A98B6E5DAF500EF
GO
Isoform 3 (identifier: A8K979-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     246-279: PTKKNFSILARNLNTIQVEEMSACNISIQGPSIY → VPKGIHAVPKLSHQQKNNPSLFMKKSLHHLIAPQ
     280-691: Missing.

Show »
Length:279
Mass (Da):31,756
Checksum:iE01128858643913C
GO
Isoform 4 (identifier: A8K979-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     245-328: VPTKKNFSIL...ASLHNVKSSL → GPFLLPSWTW...ASQTVTTEKF
     329-691: Missing.

Show »
Length:328
Mass (Da):37,479
Checksum:i5BF141A315A6EA1E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H3BN77H3BN77_HUMAN
ERI1 exoribonuclease 2
ERI2
156Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAC31669 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti352Y → C in BAA96028 (PubMed:10819331).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_043848206I → T in a colorectal cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs997506328Ensembl.1
Isoform 4 (identifier: A8K979-4)
Natural varianti268Q → K. Corresponds to variant dbSNP:rs17850670Ensembl.1
Natural varianti272G → E. Corresponds to variant dbSNP:rs2301770Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0340771 – 93Missing in isoform 2. 1 PublicationAdd BLAST93
Alternative sequenceiVSP_034078245 – 328VPTKK…VKSSL → GPFLLPSWTWNSDLASGDQH AFLQQEFGCGTYRTLLQKPN MSKQEKGNILWLTMVWLSLA CLQRKNYNDCMLNTASQTVT TEKF in isoform 4. 1 PublicationAdd BLAST84
Alternative sequenceiVSP_034079246 – 279PTKKN…GPSIY → VPKGIHAVPKLSHQQKNNPS LFMKKSLHHLIAPQ in isoform 3. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_034080280 – 691Missing in isoform 3. 1 PublicationAdd BLAST412
Alternative sequenceiVSP_034081329 – 691Missing in isoform 4. 1 PublicationAdd BLAST363

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK127391 mRNA Translation: BAC86956.1
AK292594 mRNA Translation: BAF85283.1
AC004381 Genomic DNA Translation: AAC31669.1 Sequence problems.
BC010503 mRNA Translation: AAH10503.1
AB040937 mRNA Translation: BAA96028.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS10590.1 [A8K979-4]
CCDS45436.1 [A8K979-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001136197.1, NM_001142725.1 [A8K979-1]
NP_542394.2, NM_080663.2 [A8K979-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000300005; ENSP00000300005; ENSG00000196678 [A8K979-4]
ENST00000357967; ENSP00000350651; ENSG00000196678 [A8K979-1]
ENST00000563117; ENSP00000454661; ENSG00000196678 [A8K979-2]
ENST00000564349; ENSP00000455982; ENSG00000196678 [A8K979-2]
ENST00000569729; ENSP00000457488; ENSG00000196678 [A8K979-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
112479

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:112479

UCSC genome browser

More...
UCSCi
uc002dhs.3 human [A8K979-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK127391 mRNA Translation: BAC86956.1
AK292594 mRNA Translation: BAF85283.1
AC004381 Genomic DNA Translation: AAC31669.1 Sequence problems.
BC010503 mRNA Translation: AAH10503.1
AB040937 mRNA Translation: BAA96028.1
CCDSiCCDS10590.1 [A8K979-4]
CCDS45436.1 [A8K979-1]
RefSeqiNP_001136197.1, NM_001142725.1 [A8K979-1]
NP_542394.2, NM_080663.2 [A8K979-4]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi125189, 2 interactors
IntActiA8K979, 3 interactors
MINTiA8K979
STRINGi9606.ENSP00000350651

PTM databases

iPTMnetiA8K979
PhosphoSitePlusiA8K979

Polymorphism and mutation databases

BioMutaiERI2

Proteomic databases

EPDiA8K979
jPOSTiA8K979
MaxQBiA8K979
PaxDbiA8K979
PRIDEiA8K979
ProteomicsDBi1893
1894 [A8K979-2]
1895 [A8K979-3]
1896 [A8K979-4]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
112479
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000300005; ENSP00000300005; ENSG00000196678 [A8K979-4]
ENST00000357967; ENSP00000350651; ENSG00000196678 [A8K979-1]
ENST00000563117; ENSP00000454661; ENSG00000196678 [A8K979-2]
ENST00000564349; ENSP00000455982; ENSG00000196678 [A8K979-2]
ENST00000569729; ENSP00000457488; ENSG00000196678 [A8K979-3]
GeneIDi112479
KEGGihsa:112479
UCSCiuc002dhs.3 human [A8K979-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
112479
DisGeNETi112479

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ERI2
HGNCiHGNC:30541 ERI2
HPAiHPA035384
HPA035385
neXtProtiNX_A8K979
OpenTargetsiENSG00000196678
PharmGKBiPA164719245

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0542 Eukaryota
COG5018 LUCA
GeneTreeiENSGT00530000063205
HOGENOMiHOG000112417
InParanoidiA8K979
KOiK18417
OMAiCRELTHI
OrthoDBi809000at2759
PhylomeDBiA8K979
TreeFamiTF313449

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ERI2 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
112479

Protein Ontology

More...
PROi
PR:A8K979

Gene expression databases

BgeeiENSG00000196678 Expressed in 213 organ(s), highest expression level in endometrium
ExpressionAtlasiA8K979 baseline and differential
GenevisibleiA8K979 HS

Family and domain databases

Gene3Di3.30.420.10, 1 hit
InterProiView protein in InterPro
IPR013520 Exonuclease_RNaseT/DNA_pol3
IPR012337 RNaseH-like_sf
IPR036397 RNaseH_sf
IPR010666 Znf_GRF
PfamiView protein in Pfam
PF00929 RNase_T, 1 hit
PF06839 zf-GRF, 1 hit
SMARTiView protein in SMART
SM00479 EXOIII, 1 hit
SUPFAMiSSF53098 SSF53098, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiERI2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A8K979
Secondary accession number(s): Q6ZSJ2
, Q96FR9, Q9P224, Q9Y6V3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 10, 2008
Last sequence update: June 10, 2008
Last modified: May 8, 2019
This is version 99 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again