Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 102 (13 Feb 2019)
Sequence version 3 (24 Nov 2009)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Ankyrin repeat and BTB/POZ domain-containing protein BTBD11

Gene

BTBD11

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

  • SMAD protein signal transduction Source: GO_Central

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ankyrin repeat and BTB/POZ domain-containing protein BTBD11
Alternative name(s):
BTB/POZ domain-containing protein 11
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:BTBD11
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000151136.14

Human Gene Nomenclature Database

More...
HGNCi
HGNC:23844 BTBD11

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_A6QL63

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei168 – 188HelicalSequence analysisAdd BLAST21

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
121551

Open Targets

More...
OpenTargetsi
ENSG00000151136

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134975180

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
BTBD11

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003288271 – 1104Ankyrin repeat and BTB/POZ domain-containing protein BTBD11Add BLAST1104

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
A6QL63

MaxQB - The MaxQuant DataBase

More...
MaxQBi
A6QL63

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
A6QL63

PRoteomics IDEntifications database

More...
PRIDEi
A6QL63

ProteomicsDB human proteome resource

More...
ProteomicsDBi
1742
1743 [A6QL63-2]
1744 [A6QL63-3]
1745 [A6QL63-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
A6QL63

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
A6QL63

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By all-trans retinoic acid (ATRA).

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000151136 Expressed in 141 organ(s), highest expression level in vagina

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
A6QL63 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
A6QL63 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA055898

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
125738, 2 interactors

Protein interaction database and analysis system

More...
IntActi
A6QL63, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000280758

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
A6QL63

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
A6QL63

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati603 – 632ANK 1Add BLAST30
Repeati649 – 678ANK 2Add BLAST30
Repeati687 – 716ANK 3Add BLAST30
Repeati730 – 759ANK 4Add BLAST30
Repeati825 – 854ANK 5Add BLAST30
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini923 – 989BTBPROSITE-ProRule annotationAdd BLAST67

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi280 – 330Ala-richAdd BLAST51
Compositional biasi332 – 341His-rich10

Keywords - Domaini

ANK repeat, Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IESM Eukaryota
ENOG410XRDX LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156419

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000033776

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG050447

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
A6QL63

KEGG Orthology (KO)

More...
KOi
K10483

Identification of Orthologs from Complete Genome Data

More...
OMAi
MHQKQGS

Database of Orthologous Groups

More...
OrthoDBi
416322at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
A6QL63

TreeFam database of animal gene trees

More...
TreeFami
TF106437

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00204 ANK, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.40.20, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR000210 BTB/POZ_dom
IPR009072 Histone-fold
IPR011333 SKP1/BTB/POZ_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12796 Ank_2, 1 hit
PF13606 Ank_3, 1 hit
PF00651 BTB, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00248 ANK, 4 hits
SM00225 BTB, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47113 SSF47113, 2 hits
SSF48403 SSF48403, 1 hit
SSF54695 SSF54695, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 3 hits
PS50097 BTB, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: A6QL63-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MARRGKKPVV RTLEDLTLDS GYGGAADSVR SSNLSLCCSD SHPASPYGGS
60 70 80 90 100
CWPPLADSMH SRHNSFDTVN TALVEDSEGL DCAGQHCSRL LPDLDEVPWT
110 120 130 140 150
LQELEALLLR SRDPRAGPAV PGGLPKDALA KLSTLVSRAL VRIAKEAQRL
160 170 180 190 200
SLRFAKCTKY EIQSAMEIVL SWGLAAHCTA AALAALSLYN MSSAGGDRLG
210 220 230 240 250
RGKSARCGLT FSVGRVYRWM VDSRVALRIH EHAAIYLTAC MESLFRDIYS
260 270 280 290 300
RVVASGVPRS CSGPGSGSGS GPGPSSGPGA APAADKEREA PGGGAASGGA
310 320 330 340 350
CSAASSASGG SSCCAPPAAA AAAVPPAAAA NHHHHHHHAL HEAPKFTVET
360 370 380 390 400
LEHTVNNDSE IWGLLQPYQH LICGKNASGV LCLPDSLNLH RDPQRSNKPG
410 420 430 440 450
ELPMFSQSEL RTIEQSLLAT RVGSIAELSD LVSRAMHHLQ PLNAKHHGNG
460 470 480 490 500
TPLHHKQGAL YWEPEALYTL CYFMHCPQME WENPNVEPSK VNLQVERPFL
510 520 530 540 550
VLPPLMEWIR VAVAHAGHRR SFSMDSDDVR QAARLLLPGV DCEPRQLRAD
560 570 580 590 600
DCFCASRKLD AVAIEAKFKQ DLGFRMLNCG RTDLVKQAVS LLGPDGINTM
610 620 630 640 650
SEQGMTPLMY ACVRGDEAMV QMLLDAGADL NVEVVSTPHK YPSVHPETRH
660 670 680 690 700
WTALTFAVLH GHIPVVQLLL DAGAKVEGSV EHGEENYSET PLQLAAAVGN
710 720 730 740 750
FELVSLLLER GADPLIGTMY RNGISTTPQG DMNSFSQAAA HGHRNVFRKL
760 770 780 790 800
LAQPEKEKSD ILSLEEILAE GTDLAETAPP PLCASRNSKA KLRALREAMY
810 820 830 840 850
HSAEHGYVDV TIDIRSIGVP WTLHTWLESL RIAFQQHRRP LIQCLLKEFK
860 870 880 890 900
TIQEEEYTEE LVTQGLPLMF EILKASKNEV ISQQLCVIFT HCYGPYPIPK
910 920 930 940 950
LTEIKRKQTS RLDPHFLNNK EMSDVTFLVE GRPFYAHKVL LFTASPRFKA
960 970 980 990 1000
LLSSKPTNDG TCIEIGYVKY SIFQLVMQYL YYGGPESLLI KNNEIMELLS
1010 1020 1030 1040 1050
AAKFFQLEAL QRHCEIICAK SINTDNCVDI YNHAKFLGVT ELSAYCEGYF
1060 1070 1080 1090 1100
LKNMMVLIEN EAFKQLLYDK NGEGTGQDVL QDLQRTLAIR IQSIHLSSSK

GSVV
Length:1,104
Mass (Da):120,884
Last modified:November 24, 2009 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i118D5C668CB78A3E
GO
Isoform 2 (identifier: A6QL63-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     699-817: Missing.

Note: No experimental confirmation available.
Show »
Length:985
Mass (Da):107,867
Checksum:i143A780F66A6C711
GO
Isoform 3 (identifier: A6QL63-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     998-1104: LLSAAKFFQL...HLSSSKGSVV → VRDPLWCWLS

Note: No experimental confirmation available.
Show »
Length:1,007
Mass (Da):110,143
Checksum:i01429CBB6D70708F
GO
Isoform 4 (identifier: A6QL63-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-921: Missing.

Show »
Length:183
Mass (Da):20,686
Checksum:i8EE7B21C420B83DF
GO
Isoform 5 (identifier: A6QL63-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MARRGKKPVVRTLEDLTLDSGYGGAADSVRSSN → MRKLRPKDSREPAPGSPVRSGCLQRLSHYSGIQ
     34-496: Missing.

Note: No experimental confirmation available.
Show »
Length:641
Mass (Da):71,876
Checksum:iDB1ABB3072799348
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YHR1H0YHR1_HUMAN
Ankyrin repeat and BTB/POZ domain-c...
BTBD11
222Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JV03C9JV03_HUMAN
Ankyrin repeat and BTB/POZ domain-c...
BTBD11
237Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAI01562 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAI01564 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAI46825 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence AAR21078 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAC85963 differs from that shown. Reason: Erroneous initiation.Curated
The sequence EAW97799 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti224R → H in AAI46825 (PubMed:15489334).Curated1
Sequence conflicti361I → V in BAC85963 (PubMed:14702039).Curated1
Sequence conflicti653A → V in BAG54475 (PubMed:14702039).Curated1
Sequence conflicti1043S → P in BAC03626 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_055560448G → S. Corresponds to variant dbSNP:rs1558781Ensembl.1
Natural variantiVAR_0425341002A → D. Corresponds to variant dbSNP:rs11610050Ensembl.1
Natural variantiVAR_0425351076G → S. Corresponds to variant dbSNP:rs12303478Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0328011 – 921Missing in isoform 4. 1 PublicationAdd BLAST921
Alternative sequenceiVSP_0458021 – 33MARRG…VRSSN → MRKLRPKDSREPAPGSPVRS GCLQRLSHYSGIQ in isoform 5. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_04580334 – 496Missing in isoform 5. 1 PublicationAdd BLAST463
Alternative sequenceiVSP_032802699 – 817Missing in isoform 2. 1 PublicationAdd BLAST119
Alternative sequenceiVSP_032803998 – 1104LLSAA…KGSVV → VRDPLWCWLS in isoform 3. 1 PublicationAdd BLAST107

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK091276 mRNA Translation: BAC03626.1
AK124835 mRNA Translation: BAC85963.1 Different initiation.
AK127295 mRNA Translation: BAG54475.1
AC007540 Genomic DNA No translation available.
AC007649 Genomic DNA No translation available.
AC009774 Genomic DNA No translation available.
CH471054 Genomic DNA Translation: EAW97799.1 Sequence problems.
CH471054 Genomic DNA Translation: EAW97800.1
BC093627 mRNA Translation: AAH93627.1
BC093629 mRNA Translation: AAH93629.1
BC101561 mRNA Translation: AAI01562.1 Different initiation.
BC101563 mRNA Translation: AAI01564.1 Different initiation.
BC146824 mRNA Translation: AAI46825.1 Sequence problems.
AY373588 mRNA Translation: AAR21078.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS31893.1 [A6QL63-1]
CCDS41827.1 [A6QL63-5]
CCDS86332.1 [A6QL63-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001017523.1, NM_001017523.1 [A6QL63-5]
NP_001018082.1, NM_001018072.1 [A6QL63-1]
NP_001334872.1, NM_001347943.1 [A6QL63-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.271272

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000280758; ENSP00000280758; ENSG00000151136 [A6QL63-1]
ENST00000357167; ENSP00000349690; ENSG00000151136 [A6QL63-5]
ENST00000420571; ENSP00000413889; ENSG00000151136 [A6QL63-2]
ENST00000490090; ENSP00000447319; ENSG00000151136 [A6QL63-3]
ENST00000494235; ENSP00000448322; ENSG00000151136 [A6QL63-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
121551

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:121551

UCSC genome browser

More...
UCSCi
uc001tmj.4 human [A6QL63-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK091276 mRNA Translation: BAC03626.1
AK124835 mRNA Translation: BAC85963.1 Different initiation.
AK127295 mRNA Translation: BAG54475.1
AC007540 Genomic DNA No translation available.
AC007649 Genomic DNA No translation available.
AC009774 Genomic DNA No translation available.
CH471054 Genomic DNA Translation: EAW97799.1 Sequence problems.
CH471054 Genomic DNA Translation: EAW97800.1
BC093627 mRNA Translation: AAH93627.1
BC093629 mRNA Translation: AAH93629.1
BC101561 mRNA Translation: AAI01562.1 Different initiation.
BC101563 mRNA Translation: AAI01564.1 Different initiation.
BC146824 mRNA Translation: AAI46825.1 Sequence problems.
AY373588 mRNA Translation: AAR21078.1 Different initiation.
CCDSiCCDS31893.1 [A6QL63-1]
CCDS41827.1 [A6QL63-5]
CCDS86332.1 [A6QL63-2]
RefSeqiNP_001017523.1, NM_001017523.1 [A6QL63-5]
NP_001018082.1, NM_001018072.1 [A6QL63-1]
NP_001334872.1, NM_001347943.1 [A6QL63-2]
UniGeneiHs.271272

3D structure databases

ProteinModelPortaliA6QL63
SMRiA6QL63
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125738, 2 interactors
IntActiA6QL63, 1 interactor
STRINGi9606.ENSP00000280758

PTM databases

iPTMnetiA6QL63
PhosphoSitePlusiA6QL63

Polymorphism and mutation databases

BioMutaiBTBD11

Proteomic databases

EPDiA6QL63
MaxQBiA6QL63
PaxDbiA6QL63
PRIDEiA6QL63
ProteomicsDBi1742
1743 [A6QL63-2]
1744 [A6QL63-3]
1745 [A6QL63-4]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000280758; ENSP00000280758; ENSG00000151136 [A6QL63-1]
ENST00000357167; ENSP00000349690; ENSG00000151136 [A6QL63-5]
ENST00000420571; ENSP00000413889; ENSG00000151136 [A6QL63-2]
ENST00000490090; ENSP00000447319; ENSG00000151136 [A6QL63-3]
ENST00000494235; ENSP00000448322; ENSG00000151136 [A6QL63-4]
GeneIDi121551
KEGGihsa:121551
UCSCiuc001tmj.4 human [A6QL63-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
121551
DisGeNETi121551
EuPathDBiHostDB:ENSG00000151136.14

GeneCards: human genes, protein and diseases

More...
GeneCardsi
BTBD11
HGNCiHGNC:23844 BTBD11
HPAiHPA055898
neXtProtiNX_A6QL63
OpenTargetsiENSG00000151136
PharmGKBiPA134975180

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IESM Eukaryota
ENOG410XRDX LUCA
GeneTreeiENSGT00940000156419
HOGENOMiHOG000033776
HOVERGENiHBG050447
InParanoidiA6QL63
KOiK10483
OMAiMHQKQGS
OrthoDBi416322at2759
PhylomeDBiA6QL63
TreeFamiTF106437

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
BTBD11 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
121551

Protein Ontology

More...
PROi
PR:A6QL63

Gene expression databases

BgeeiENSG00000151136 Expressed in 141 organ(s), highest expression level in vagina
ExpressionAtlasiA6QL63 baseline and differential
GenevisibleiA6QL63 HS

Family and domain databases

CDDicd00204 ANK, 1 hit
Gene3Di1.25.40.20, 1 hit
InterProiView protein in InterPro
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR000210 BTB/POZ_dom
IPR009072 Histone-fold
IPR011333 SKP1/BTB/POZ_sf
PfamiView protein in Pfam
PF12796 Ank_2, 1 hit
PF13606 Ank_3, 1 hit
PF00651 BTB, 1 hit
SMARTiView protein in SMART
SM00248 ANK, 4 hits
SM00225 BTB, 1 hit
SUPFAMiSSF47113 SSF47113, 2 hits
SSF48403 SSF48403, 1 hit
SSF54695 SSF54695, 1 hit
PROSITEiView protein in PROSITE
PS50297 ANK_REP_REGION, 1 hit
PS50088 ANK_REPEAT, 3 hits
PS50097 BTB, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiBTBDB_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A6QL63
Secondary accession number(s): A4FU41
, B3KXG3, C9J019, C9JK80, E9PHS4, Q3ZTQ4, Q52M89, Q6ZV99, Q8N245
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 8, 2008
Last sequence update: November 24, 2009
Last modified: February 13, 2019
This is version 102 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again