Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Forkhead-associated domain-containing protein 1

Gene

Fhad1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Forkhead-associated domain-containing protein 1
Short name:
FHA domain-containing protein 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Fhad1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1920323 Fhad1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003493661 – 1420Forkhead-associated domain-containing protein 1Add BLAST1420

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
A6PWD2

MaxQB - The MaxQuant DataBase

More...
MaxQBi
A6PWD2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
A6PWD2

PRoteomics IDEntifications database

More...
PRIDEi
A6PWD2

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
A6PWD2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
A6PWD2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000051435 Expressed in 136 organ(s), highest expression level in testis

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
A6PWD2 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
236875, 1 interactor

Protein interaction database and analysis system

More...
IntActi
A6PWD2, 2 interactors

Molecular INTeraction database

More...
MINTi
A6PWD2

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
A6PWD2

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
A6PWD2

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini18 – 69FHAPROSITE-ProRule annotationAdd BLAST52

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili241 – 495Sequence analysisAdd BLAST255
Coiled coili646 – 915Sequence analysisAdd BLAST270
Coiled coili1003 – 1060Sequence analysisAdd BLAST58
Coiled coili1111 – 1140Sequence analysisAdd BLAST30
Coiled coili1256 – 1335Sequence analysisAdd BLAST80

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi98 – 159Pro-richAdd BLAST62

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IEEP Eukaryota
ENOG4110M3I LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154171

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000112586

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG107918

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
A6PWD2

Identification of Orthologs from Complete Genome Data

More...
OMAi
MCDISVQ

Database of Orthologous Groups

More...
OrthoDBi
EOG091G04K9

Database for complete collections of gene phylogenies

More...
PhylomeDBi
A6PWD2

TreeFam database of animal gene trees

More...
TreeFami
TF328548

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00060 FHA, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000253 FHA_dom
IPR008984 SMAD_FHA_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00498 FHA, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00240 FHA, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49879 SSF49879, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50006 FHA_DOMAIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: A6PWD2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKAYLKSADG FFVLNKSTTI GKHADSDLVL QSADIDNHHA LIEFNEAEGT
60 70 80 90 100
FVLQDFNSRN GTFVNECHIQ NVAVKLIPGD ILRFGSAGMT YELVIENPSP
110 120 130 140 150
VSCPWVRGPA PWPSPQPHLS SSPPDMPFHH GIQPATVQRS WSQGCPRPTM
160 170 180 190 200
VPPAPHQRPM SASGKMFSFV MDPKSPVINQ VWANAMDMSE QCMMDGLSGT
210 220 230 240 250
IPPTEIFMDH DLSQQDKDEI ILLLGREVNR LSDFEMESKY KDALIMNLQA
260 270 280 290 300
EVADLSQRLS ETAAVAAARQ SNRCDPKLQG VDEGDDLRQK EIESMKSQIN
310 320 330 340 350
ALQKGYSQVL SQTLAERNTE IESLKNEGEN LKRDHAITSG MVTSLQKDMS
360 370 380 390 400
ARNEQVQQLQ EEVNRLRIEN REKEYQLEAL SSRCSVMKEE LRKEEAQKDR
410 420 430 440 450
REAQEKELKL CRSQMQDMEK EVRKLREELK KNYMGQNIIS KTLREKNKVE
460 470 480 490 500
EKLQEDSRRK LLQLQEMGNR ENLIKINLER AVGQLENFRN QVIKATFGKT
510 520 530 540 550
KPFRDKPITD QQLIEKIIQV TEDNLSFQQR KWTLQRETHL HPKQEETMHS
560 570 580 590 600
VEKLRVLLDK CQACMRDSCS SIDLKKEVEL LQHLPLSPLV SGLQKTVVNI
610 620 630 640 650
LRVSLSWLEE TEQLLGDLDI ELSDSDKGFS LCLIYLLEHY KKIMSQSQDL
660 670 680 690 700
QAQMNASRET QKSLRQEHLA EKEKLAEKLE QEEKLKAKIQ QLTEEKAALE
710 720 730 740 750
ESIGQEKSRS EEALEKAQAR VRELENHLAS QKEALENSVA QEKRKMREML
760 770 780 790 800
EAERRKAQDL ENQLTQQKEI SENNTYEKLK MRDTLEKEKR KIQDLENRLT
810 820 830 840 850
KQKEEIELKE QKENVLNNKL KDALVMVEDA QQMKTTESQR AETLALKLKE
860 870 880 890 900
TLAELETTKT KMILTDDRLK LQQQSMKALQ DERESQKHGF EEEISEYKEQ
910 920 930 940 950
IKQHSQTIVS LEERLCQVTQ YYQKIEGEIT TLKNNDTGPK EEASQDLTAG
960 970 980 990 1000
PPLDSGDKEI ACDHLIDDLL MAQKEILSQQ EIIMKLRTDL GEAHSRMSDL
1010 1020 1030 1040 1050
RGELSEKQKM ELERQVALVR QQSGELSMLK AKVAQTTGLM EKKDRELKVL
1060 1070 1080 1090 1100
REALRASQEK PRPHLSTEQK PRTLSQKCDI SLQIEPAHPD SFSSFQEEQS
1110 1120 1130 1140 1150
FSDLGVKCKG SRHEETIQRQ RKALSELRTR VRELEKANSC NHKDHVNESF
1160 1170 1180 1190 1200
LELRTLRMEK NVQKILLDAK PDLTTLARVE IRPPQNSPFN SGSTLVMEKS
1210 1220 1230 1240 1250
VKTDAGEALE LSEKLYTDMI KTLGSLMNIK DMSSHTSLKH LSPKEREKVN
1260 1270 1280 1290 1300
HLRQKDLDLV FDKITQLKTR LQRKEELLKG YEQELEQLRH SKVSVQMYQT
1310 1320 1330 1340 1350
QVAKLEDDVH KEAEEKALLK EALERTEQQL SQERRFNRVF KQQKDRGEDP
1360 1370 1380 1390 1400
EQRNMSYSPF KDNEKQRRLF VEMVKSKMQN SSVQAGAKKA TLKTGQERET
1410 1420
KKEAYKSTQS LSFVKPGGKN
Length:1,420
Mass (Da):163,728
Last modified:August 21, 2007 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6F0595B646BDA4D0
GO
Isoform 2 (identifier: A6PWD2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-696: Missing.
     697-697: A → MLEVEKQTTQGPGRVHSLPWQQADSTAAVGLQ
     1056-1061: ASQEKP → CGKGSV
     1062-1420: Missing.

Note: No experimental confirmation available.
Show »
Length:396
Mass (Da):45,553
Checksum:i026FBD06EACB763E
GO
Isoform 3 (identifier: A6PWD2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     450-463: EEKLQEDSRRKLLQ → RASRKLDCVHDNGR
     464-1420: Missing.

Note: No experimental confirmation available.
Show »
Length:463
Mass (Da):52,482
Checksum:iF26DC4EF077E5B95
GO
Isoform 4 (identifier: A6PWD2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-564: Missing.

Note: No experimental confirmation available.
Show »
Length:856
Mass (Da):99,153
Checksum:iFB201CD26CBF5775
GO
Isoform 5 (identifier: A6PWD2-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-825: Missing.
     1056-1061: ASQEKP → CGKGSV
     1062-1420: Missing.

Show »
Length:236
Mass (Da):26,936
Checksum:i65C4B7943936B32F
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti755R → G in BAE28583 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0353701 – 825Missing in isoform 5. 1 PublicationAdd BLAST825
Alternative sequenceiVSP_0353711 – 696Missing in isoform 2. 1 PublicationAdd BLAST696
Alternative sequenceiVSP_0353721 – 564Missing in isoform 4. 1 PublicationAdd BLAST564
Alternative sequenceiVSP_035373450 – 463EEKLQ…RKLLQ → RASRKLDCVHDNGR in isoform 3. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_035374464 – 1420Missing in isoform 3. 1 PublicationAdd BLAST957
Alternative sequenceiVSP_035375697A → MLEVEKQTTQGPGRVHSLPW QQADSTAAVGLQ in isoform 2. 1 Publication1
Alternative sequenceiVSP_0353761056 – 1061ASQEKP → CGKGSV in isoform 2 and isoform 5. 2 Publications6
Alternative sequenceiVSP_0353771062 – 1420Missing in isoform 2 and isoform 5. 2 PublicationsAdd BLAST359

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK013832 mRNA Translation: BAB29008.1
AK045799 mRNA Translation: BAC32497.1
AK148490 mRNA Translation: BAE28583.1
AL645731 Genomic DNA Translation: CAM23932.2
AL645731, AL663037 Genomic DNA Translation: CAO77740.1
AL663037, AL645731 Genomic DNA Translation: CAO78111.1
BC038692 mRNA Translation: AAH38692.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS51349.1 [A6PWD2-1]

NCBI Reference Sequences

More...
RefSeqi
NP_808536.2, NM_177868.4 [A6PWD2-1]
XP_006539019.1, XM_006538956.3 [A6PWD2-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Mm.252019

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000036701; ENSMUSP00000036224; ENSMUSG00000051435 [A6PWD2-2]
ENSMUST00000105779; ENSMUSP00000101405; ENSMUSG00000051435 [A6PWD2-1]
ENSMUST00000105780; ENSMUSP00000101406; ENSMUSG00000051435 [A6PWD2-1]
ENSMUST00000229123; ENSMUSP00000155568; ENSMUSG00000116181 [A6PWD2-1]
ENSMUST00000230228; ENSMUSP00000155563; ENSMUSG00000116181 [A6PWD2-2]
ENSMUST00000231201; ENSMUSP00000155716; ENSMUSG00000116181 [A6PWD2-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
329977

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:329977

UCSC genome browser

More...
UCSCi
uc008vpm.1 mouse [A6PWD2-5]
uc008vpn.1 mouse [A6PWD2-2]
uc008vpp.1 mouse [A6PWD2-3]
uc012dog.2 mouse [A6PWD2-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK013832 mRNA Translation: BAB29008.1
AK045799 mRNA Translation: BAC32497.1
AK148490 mRNA Translation: BAE28583.1
AL645731 Genomic DNA Translation: CAM23932.2
AL645731, AL663037 Genomic DNA Translation: CAO77740.1
AL663037, AL645731 Genomic DNA Translation: CAO78111.1
BC038692 mRNA Translation: AAH38692.1
CCDSiCCDS51349.1 [A6PWD2-1]
RefSeqiNP_808536.2, NM_177868.4 [A6PWD2-1]
XP_006539019.1, XM_006538956.3 [A6PWD2-1]
UniGeneiMm.252019

3D structure databases

ProteinModelPortaliA6PWD2
SMRiA6PWD2
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi236875, 1 interactor
IntActiA6PWD2, 2 interactors
MINTiA6PWD2

PTM databases

iPTMnetiA6PWD2
PhosphoSitePlusiA6PWD2

Proteomic databases

EPDiA6PWD2
MaxQBiA6PWD2
PaxDbiA6PWD2
PRIDEiA6PWD2

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000036701; ENSMUSP00000036224; ENSMUSG00000051435 [A6PWD2-2]
ENSMUST00000105779; ENSMUSP00000101405; ENSMUSG00000051435 [A6PWD2-1]
ENSMUST00000105780; ENSMUSP00000101406; ENSMUSG00000051435 [A6PWD2-1]
ENSMUST00000229123; ENSMUSP00000155568; ENSMUSG00000116181 [A6PWD2-1]
ENSMUST00000230228; ENSMUSP00000155563; ENSMUSG00000116181 [A6PWD2-2]
ENSMUST00000231201; ENSMUSP00000155716; ENSMUSG00000116181 [A6PWD2-1]
GeneIDi329977
KEGGimmu:329977
UCSCiuc008vpm.1 mouse [A6PWD2-5]
uc008vpn.1 mouse [A6PWD2-2]
uc008vpp.1 mouse [A6PWD2-3]
uc012dog.2 mouse [A6PWD2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
114827
MGIiMGI:1920323 Fhad1

Phylogenomic databases

eggNOGiENOG410IEEP Eukaryota
ENOG4110M3I LUCA
GeneTreeiENSGT00940000154171
HOGENOMiHOG000112586
HOVERGENiHBG107918
InParanoidiA6PWD2
OMAiMCDISVQ
OrthoDBiEOG091G04K9
PhylomeDBiA6PWD2
TreeFamiTF328548

Miscellaneous databases

Protein Ontology

More...
PROi
PR:A6PWD2

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000051435 Expressed in 136 organ(s), highest expression level in testis
GenevisibleiA6PWD2 MM

Family and domain databases

CDDicd00060 FHA, 1 hit
InterProiView protein in InterPro
IPR000253 FHA_dom
IPR008984 SMAD_FHA_dom_sf
PfamiView protein in Pfam
PF00498 FHA, 1 hit
SMARTiView protein in SMART
SM00240 FHA, 1 hit
SUPFAMiSSF49879 SSF49879, 1 hit
PROSITEiView protein in PROSITE
PS50006 FHA_DOMAIN, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFHAD1_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A6PWD2
Secondary accession number(s): A2AAC3
, Q3UFH8, Q8BLA4, Q8CHV8, Q9CUV2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 2, 2008
Last sequence update: August 21, 2007
Last modified: December 5, 2018
This is version 79 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again