Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 92 (13 Feb 2019)
Sequence version 4 (08 Mar 2011)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Protein monoglycylase TTLL8

Gene

TTLL8

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Monoglycylase which modifies both tubulin and non-tubulin proteins, generating side chains of glycine on the gamma-carboxyl groups of specific glutamate residues of target proteins. Monoglycylates tubulin, with a preference for alpha-tubulin toward beta-tubulin. Has the ability to modify non-tubulin proteins such as ANP32A, ANP32B, SET and NCL. Involved in the side-chain initiation step of the glycylation reaction by adding a single glycine chain to generate monoglycine side chains. Not involved in elongation step of the polyglycylation reaction (By similarity).By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei405ATPBy similarity1
Binding sitei407ATPBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi392 – 395ATP bindingBy similarity4

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionLigase
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-8955332 Carboxyterminal post-translational modifications of tubulin

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein monoglycylase TTLL8 (EC:6.3.2.-)
Alternative name(s):
Tubulin--tyrosine ligase-like protein 8
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TTLL8
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 22

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000138892.11

Human Gene Nomenclature Database

More...
HGNCi
HGNC:34000 TTLL8

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_A6PVC2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Cytoskeleton, Microtubule

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162407295

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TTLL8

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003406451 – 850Protein monoglycylase TTLL8Add BLAST850

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
A6PVC2

PRoteomics IDEntifications database

More...
PRIDEi
A6PVC2

ProteomicsDB human proteome resource

More...
ProteomicsDBi
1667

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
A6PVC2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
A6PVC2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000138892 Expressed in 29 organ(s), highest expression level in testis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
A6PVC2 baseline and differential

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA016882

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000392252

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
A6PVC2

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
A6PVC2

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini222 – 580TTLPROSITE-ProRule annotationAdd BLAST359

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2157 Eukaryota
ENOG410XQDM LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000162265

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000154711

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG069401

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
A6PVC2

Database for complete collections of gene phylogenies

More...
PhylomeDBi
A6PVC2

TreeFam database of animal gene trees

More...
TreeFami
TF313087

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR004344 TTL/TTLL_fam

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03133 TTL, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51221 TTL, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: A6PVC2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEPERKGLSL ASSSDGDGRE ENKLKQGISQ DLASSSRLDR YKIARQLTEK
60 70 80 90 100
AIKEKKIFSI YGHYPVVRAA LRRKGWVEKK FHFLPKVIPD VEDEGARVND
110 120 130 140 150
DTCAKVKENQ EMALEKTDNI HDVMSRLVKN EMPYLLWTIK RDIIDYHSLT
160 170 180 190 200
YDQMLNHYAK TASFTTKIGL CVNMRSLPWY VPANPDSFFP RCYSLCTESE
210 220 230 240 250
QQEFLEDFRR TMASSILKWV VSHQSCSRSS RSKPRDQREE AGSSDLSSRQ
260 270 280 290 300
DAENAEAKLR GLPGQLVDIA CKVCQAYLGQ LEHEDIDTSA DAVEDLTEAE
310 320 330 340 350
WEDLTQQYYS LVHGDAFISN SRNYFSQCQA LLNRITSVNP QTDIDGLRNI
360 370 380 390 400
WIIKPAAKSR GRDIVCMDRV EEILELAAAD HPLSRDNKWV VQKYIETPLL
410 420 430 440 450
ICDTKFDIRQ WFLVTDWNPL TIWFYKESYL RFSTQRFSLD KLDSAIHLCN
460 470 480 490 500
NAVQKYLKND VGRSPLLPAH NMWTSTRFQE YLQRQGRGAV WGSVIYPSMK
510 520 530 540 550
KAIAHAMKVA QDHVEPRKNS FELYGADFVL GRDFRPWLIE INSSPTMHPS
560 570 580 590 600
TPVTAQLCAQ VQEDTIKVAV DRSCDIGNFE LLWRQPVVEP PPFSGSDLCV
610 620 630 640 650
AGVSVRRARR QVLPVCNLKA SASLLDAQPL KARGPSAMPD PAQGPPSPAL
660 670 680 690 700
QRDLGLKEEK GLPLALLAPL RGAAESGGAA QPTRTKAAGK VELPACPCRH
710 720 730 740 750
VDSQAPNTGV PVAQPAKSWD PNQLNAHPLE PVLRGLKTAE GALRPPPGGK
760 770 780 790 800
GEGTVCSRLP HHGHHVAACQ TTGTTWDGGP GVCFLRQLLA SELPMGPGLP
810 820 830 840 850
RDPRAPPCLV CRGLLPPAGP CKRCRSFCAA VLQGASFVRL GGRSCSPRTP
Length:850
Mass (Da):94,676
Last modified:March 8, 2011 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5867C8684801DBDD
GO
Isoform 2 (identifier: A6PVC2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: MEPERKGLSLASSSDGDGREENKLKQGISQDLASSSRLDRYKIARQLTEKAIK → MRLLDGKQTSRYSENAC
     313-326: HGDAFISNSRNYFS → QVPLGSSIVLCIFKIQKVMMSFEPPTARDR
     362-362: R → RGESP

Note: No experimental confirmation available.
Show »
Length:834
Mass (Da):92,903
Checksum:i741172CD1F70686C
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1C7CYW9A0A1C7CYW9_HUMAN
Protein monoglycylase TTLL8
TTLL8
849Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_061867127L → W. Corresponds to variant dbSNP:rs59727397Ensembl.1
Natural variantiVAR_057316191R → H. Corresponds to variant dbSNP:rs17013076Ensembl.1
Natural variantiVAR_057317294E → K. Corresponds to variant dbSNP:rs9628315Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0540071 – 53MEPER…EKAIK → MRLLDGKQTSRYSENAC in isoform 2. CuratedAdd BLAST53
Alternative sequenceiVSP_054008313 – 326HGDAF…RNYFS → QVPLGSSIVLCIFKIQKVMM SFEPPTARDR in isoform 2. CuratedAdd BLAST14
Alternative sequenceiVSP_054009362R → RGESP in isoform 2. Curated1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AL022327 Genomic DNA No translation available.
CR745100 mRNA No translation available.

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.526713

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000266182; ENSP00000266182; ENSG00000138892 [A6PVC2-2]

UCSC genome browser

More...
UCSCi
uc062fiv.1 human [A6PVC2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL022327 Genomic DNA No translation available.
CR745100 mRNA No translation available.
UniGeneiHs.526713

3D structure databases

ProteinModelPortaliA6PVC2
SMRiA6PVC2
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000392252

PTM databases

iPTMnetiA6PVC2
PhosphoSitePlusiA6PVC2

Polymorphism and mutation databases

BioMutaiTTLL8

Proteomic databases

PaxDbiA6PVC2
PRIDEiA6PVC2
ProteomicsDBi1667

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000266182; ENSP00000266182; ENSG00000138892 [A6PVC2-2]
UCSCiuc062fiv.1 human [A6PVC2-1]

Organism-specific databases

EuPathDBiHostDB:ENSG00000138892.11

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TTLL8
HGNCiHGNC:34000 TTLL8
HPAiHPA016882
neXtProtiNX_A6PVC2
PharmGKBiPA162407295

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2157 Eukaryota
ENOG410XQDM LUCA
GeneTreeiENSGT00940000162265
HOGENOMiHOG000154711
HOVERGENiHBG069401
InParanoidiA6PVC2
PhylomeDBiA6PVC2
TreeFamiTF313087

Enzyme and pathway databases

ReactomeiR-HSA-8955332 Carboxyterminal post-translational modifications of tubulin

Miscellaneous databases

Protein Ontology

More...
PROi
PR:A6PVC2

Gene expression databases

BgeeiENSG00000138892 Expressed in 29 organ(s), highest expression level in testis
ExpressionAtlasiA6PVC2 baseline and differential

Family and domain databases

InterProiView protein in InterPro
IPR004344 TTL/TTLL_fam
PfamiView protein in Pfam
PF03133 TTL, 1 hit
PROSITEiView protein in PROSITE
PS51221 TTL, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTTLL8_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A6PVC2
Secondary accession number(s): B5MDV0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 10, 2008
Last sequence update: March 8, 2011
Last modified: February 13, 2019
This is version 92 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again