Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - A6NNW6 (ENO4_HUMAN)

Entry version 88 (13 Feb 2019)
Sequence version 4 (05 Dec 2018)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Enolase 4

Gene

ENO4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be required for sperm motility and function.By similarity

Caution

Although it belongs to the enolase family, Leu-362 is present instead of the conserved Glu which is expected to be an active site residue.Curated

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: glycolysis

This protein is involved in step 4 of the subpathway that synthesizes pyruvate from D-glyceraldehyde 3-phosphate.By similarity
Proteins known to be involved in the 5 steps of the subpathway in this organism are:
  1. Glyceraldehyde-3-phosphate dehydrogenase, Glyceraldehyde-3-phosphate dehydrogenase (HEL-S-278), Glyceraldehyde-3-phosphate dehydrogenase (HEL-S-162eP), Glyceraldehyde-3-phosphate dehydrogenase (GAPDH), Glyceraldehyde-3-phosphate dehydrogenase, testis-specific (GAPDHS)
  2. Phosphoglycerate kinase, Phosphoglycerate kinase (HEL-S-68p), Phosphoglycerate kinase, Phosphoglycerate kinase, Phosphoglycerate kinase, Phosphoglycerate kinase (HEL-S-272), Phosphoglycerate kinase, Phosphoglycerate kinase 1 (PGK1), Phosphoglycerate kinase 2 (PGK2)
  3. no protein annotated in this organism
  4. Enolase 4 (ENO4), Alpha-enolase (ENO1), Beta-enolase (ENO3), Gamma-enolase (ENO2)
  5. Pyruvate kinase (PKM2), Pyruvate kinase (PKM), Pyruvate kinase (PKM), Pyruvate kinase (PKM), Pyruvate kinase (PKM), Pyruvate kinase (PKM2), Pyruvate kinase (PKM2), Pyruvate kinase, Pyruvate kinase, Pyruvate kinase (PKM2), Pyruvate kinase, Pyruvate kinase (HEL-S-30), Pyruvate kinase, Pyruvate kinase PKM (PKM), Pyruvate kinase PKLR (PKLR)
This subpathway is part of the pathway glycolysis, which is itself part of Carbohydrate degradation.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes pyruvate from D-glyceraldehyde 3-phosphate, the pathway glycolysis and in Carbohydrate degradation.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei300SubstrateBy similarity1
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei497Proton acceptorBy similarity1
Binding sitei548SubstrateBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

View the complete GO annotation on QuickGO ...

GO - Biological processi

View the complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionLyase
Biological processGlycolysis

Enzyme and pathway databases

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...UniPathwayi
UPA00109;UER00187

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Enolase 4Curated (EC:4.2.1.11)
Alternative name(s):
2-phospho-D-glycerate hydro-lyase
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ENO4Imported
Synonyms:C10orf134
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000188316.13

Human Gene Nomenclature Database

More...HGNCi		HGNC:31670 ENO4

neXtProt; the human protein knowledge platform

More...neXtProti		NX_A6NNW6

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		387712

Open Targets

More...OpenTargetsi		ENSG00000188316

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		ENO4

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003484541 – 625Enolase 4Add BLAST625

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		A6NNW6

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		A6NNW6

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		A6NNW6

PRoteomics IDEntifications database

More...PRIDEi		A6NNW6

ProteomicsDB human proteome resource

More...ProteomicsDBi		1643
1644 [A6NNW6-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		A6NNW6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		A6NNW6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000188316 Expressed in 82 organ(s), highest expression level in nucleus accumbens

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		A6NNW6 baseline and differential

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA037938
HPA061509

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with ENO1 and AKAP4.By similarity

Protein-protein interaction databases

Protein interaction database and analysis system

More...IntActi		A6NNW6, 2 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000345555

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...ProteinModelPortali		A6NNW6

Database of comparative protein structure models

More...ModBasei		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi189 – 231Pro-richAdd BLAST43

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the enolase family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG2670 Eukaryota
COG0148 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000155260

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000293284

The HOVERGEN Database of Homologous Vertebrate Genes

More...HOVERGENi		HBG107850

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		A6NNW6

KEGG Orthology (KO)

More...KOi		K01689

Identification of Orthologs from Complete Genome Data

More...OMAi		QVEIFCT

Database of Orthologous Groups

More...OrthoDBi		1097401at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		A6NNW6

TreeFam database of animal gene trees

More...TreeFami		TF354238

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.20.20.120, 1 hit
3.30.390.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR000941 Enolase
IPR036849 Enolase-like_C_sf
IPR029017 Enolase-like_N
IPR020810 Enolase_C
IPR020811 Enolase_N

The PANTHER Classification System

More...PANTHERi		PTHR11902 PTHR11902, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00113 Enolase_C, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM01192 Enolase_C, 1 hit
SM01193 Enolase_N, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF51604 SSF51604, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 3 (identifier: A6NNW6-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEEEGGGRSC GTTRELQKLK QQAMEYYREN DVPRRLEELL NSTFYLQPAD 
        60         70         80         90        100
VYGHLANCFS KLAKPPTICK IVGKDVLDGL GLPTLQVDIF CTIQNFPKNV 
       110        120        130        140        150
CSVVISTHFE VHENALPELA KAEEAERASA VSTAVQWVNS TITHELQGMA 
       160        170        180        190        200
PSDQAEVDHL LRIFFASKVQ EDKGRKELEK SLEYSTVPTP LPPVPPPPPP 
       210        220        230        240        250
PPPTKKKGQK PGRKDTITEK PIAPAEPVEP VLSGSMAIGA VSLAVAKACA 
       260        270        280        290        300
MLLNKPLYLN IALLKHNQEQ PTTLSMPLLM VSLVSCGKSS SGKLNLMKEV 
       310        320        330        340        350
ICIPHPELTT KQGVEMLMEM QKHINKIIEM PSPPKAETKK GHDGSKRGQQ 
       360        370        380        390        400
QITGKMSHLG CLTINCDSIE QPLLLIQEIC ANLGLELGTN LHLAINCAGH 
       410        420        430        440        450
ELMDYNKGKY EVIMGTYKNA AEMVDLYVDL INKYPSIIAL IDPFRKEDSE 
       460        470        480        490        500
QWDSIYHALG SRCYIIAGTA SKSISKLLEQ GNISIPKSNG LIIKHTNQTT 
       510        520        530        540        550
MSDLVEITNL IDSKKHITVF GSTEGESSDD SLVDLAVGLG VRFIKLGGLS 
       560        570        580        590        600
RGERVTKYNR LLTIEEELVQ NGTLGFKEEH TFFYFNEEAE KAAEALEAAA 
       610        620 
AREPLVPTFP TQGVEESAET GASSG
Length:625
Mass (Da):68,465
Last modified:December 5, 2018 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3FE6180EE2D83CE5
GO
Isoform 2 (identifier: A6NNW6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     56-330: Missing.
     406-448: NKGKYEVIMGTYKNAAEMVDLYVDLINKYPSIIALIDPFRKED → D

Show »
Length:308
Mass (Da):33,793
Checksum:i454F89A2A13D18AC
GO
Isoform 4 (identifier: A6NNW6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-235: Missing.
     575-598: GFKEEHTFFYFNEEAEKAAEALEA → ATSSSSCDARIGGQEQETMTLVKV
     599-625: Missing.

Note: No experimental confirmation available.
Show »
Length:363
Mass (Da):39,641
Checksum:i542EB5CC325D5C05
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
S4R3X7S4R3X7_HUMAN
Enolase 4
ENO4
138Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti32V → I in BX647301 (PubMed:17974005).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0599491 – 235Missing in isoform 4. Add BLAST235
Alternative sequenceiVSP_05994756 – 330Missing in isoform 2. Add BLAST275
Alternative sequenceiVSP_059948406 – 448NKGKY…FRKED → D in isoform 2. Add BLAST43
Alternative sequenceiVSP_059951575 – 598GFKEE…EALEA → ATSSSSCDARIGGQEQETMT LVKV in isoform 4. Add BLAST24
Alternative sequenceiVSP_059950599 – 625Missing in isoform 4. Add BLAST27

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
BX647301 mRNA No translation available.
AC023283 Genomic DNA No translation available.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS73206.1 [A6NNW6-3]

NCBI Reference Sequences

More...RefSeqi		NP_001229628.1, NM_001242699.1 [A6NNW6-3]

UniGene gene-oriented nucleotide sequence clusters

More...UniGenei		Hs.693248

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000341276; ENSP00000345555; ENSG00000188316 [A6NNW6-3]
ENST00000369207; ENSP00000358208; ENSG00000188316 [A6NNW6-4]
ENST00000409522; ENSP00000387194; ENSG00000188316 [A6NNW6-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		387712

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:387712

UCSC genome browser

More...UCSCi		uc001lcw.4 human [A6NNW6-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
BX647301 mRNA No translation available.
AC023283 Genomic DNA No translation available.
CCDSiCCDS73206.1 [A6NNW6-3]
RefSeqiNP_001229628.1, NM_001242699.1 [A6NNW6-3]
UniGeneiHs.693248

3D structure databases

ProteinModelPortaliA6NNW6
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiA6NNW6, 2 interactors
STRINGi9606.ENSP00000345555

PTM databases

iPTMnetiA6NNW6
PhosphoSitePlusiA6NNW6

Polymorphism and mutation databases

BioMutaiENO4

Proteomic databases

EPDiA6NNW6
jPOSTiA6NNW6
PaxDbiA6NNW6
PRIDEiA6NNW6
ProteomicsDBi1643
1644 [A6NNW6-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000341276; ENSP00000345555; ENSG00000188316 [A6NNW6-3]
ENST00000369207; ENSP00000358208; ENSG00000188316 [A6NNW6-4]
ENST00000409522; ENSP00000387194; ENSG00000188316 [A6NNW6-2]
GeneIDi387712
KEGGihsa:387712
UCSCiuc001lcw.4 human [A6NNW6-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		387712
DisGeNETi387712
EuPathDBiHostDB:ENSG00000188316.13

GeneCards: human genes, protein and diseases

More...GeneCardsi		ENO4

H-Invitational Database, human transcriptome db

More...H-InvDBi		HIX0026101
HGNCiHGNC:31670 ENO4
HPAiHPA037938
HPA061509
neXtProtiNX_A6NNW6
OpenTargetsiENSG00000188316

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG2670 Eukaryota
COG0148 LUCA
GeneTreeiENSGT00940000155260
HOGENOMiHOG000293284
HOVERGENiHBG107850
InParanoidiA6NNW6
KOiK01689
OMAiQVEIFCT
OrthoDBi1097401at2759
PhylomeDBiA6NNW6
TreeFamiTF354238

Enzyme and pathway databases

UniPathwayi
UPA00109;UER00187

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		ENO4 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		387712

Protein Ontology

More...PROi		PR:A6NNW6

Gene expression databases

BgeeiENSG00000188316 Expressed in 82 organ(s), highest expression level in nucleus accumbens
ExpressionAtlasiA6NNW6 baseline and differential

Family and domain databases

Gene3Di3.20.20.120, 1 hit
3.30.390.10, 1 hit
InterProiView protein in InterPro
IPR000941 Enolase
IPR036849 Enolase-like_C_sf
IPR029017 Enolase-like_N
IPR020810 Enolase_C
IPR020811 Enolase_N
PANTHERiPTHR11902 PTHR11902, 1 hit
PfamiView protein in Pfam
PF00113 Enolase_C, 1 hit
SMARTiView protein in SMART
SM01192 Enolase_C, 1 hit
SM01193 Enolase_N, 1 hit
SUPFAMiSSF51604 SSF51604, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiENO4_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A6NNW6
Secondary accession number(s): A0A087WZY6
, A6NI74, B8ZZN9, J3KNX1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 2, 2008
Last sequence update: December 5, 2018
Last modified: February 13, 2019
This is version 88 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again