Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Coiled-coil domain-containing protein 169

Gene

CCDC169

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Coiled-coil domain-containing protein 169
Gene namesi
Name:CCDC169
Synonyms:C13orf38
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 13

Organism-specific databases

EuPathDBiHostDB:ENSG00000242715.7
HGNCiHGNC:34361 CCDC169
neXtProtiNX_A6NNP5

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000242715
PharmGKBiPA162378105

Polymorphism and mutation databases

BioMutaiCCDC169

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003413661 – 214Coiled-coil domain-containing protein 169Add BLAST214

Proteomic databases

PaxDbiA6NNP5
PRIDEiA6NNP5
ProteomicsDBi1625
1626 [A6NNP5-2]
1627 [A6NNP5-3]
1628 [A6NNP5-4]
1629 [A6NNP5-5]
1630 [A6NNP5-6]

PTM databases

iPTMnetiA6NNP5
PhosphoSitePlusiA6NNP5

Expressioni

Gene expression databases

BgeeiENSG00000242715 Expressed in 94 organ(s), highest expression level in sperm
ExpressionAtlasiA6NNP5 baseline and differential
GenevisibleiA6NNP5 HS

Structurei

3D structure databases

ProteinModelPortaliA6NNP5
SMRiA6NNP5
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili29 – 154Sequence analysisAdd BLAST126

Sequence similaritiesi

Belongs to the CCDC169 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IWC3 Eukaryota
ENOG4111UKE LUCA
GeneTreeiENSGT00390000011174
HOGENOMiHOG000082544
HOVERGENiHBG090707
InParanoidiA6NNP5
OMAiEIHMKDL
OrthoDBiEOG091G0OFA
PhylomeDBiA6NNP5
TreeFamiTF329642

Family and domain databases

InterProiView protein in InterPro
IPR028022 DUF4600
PANTHERiPTHR28671 PTHR28671, 1 hit
PfamiView protein in Pfam
PF15372 DUF4600, 1 hit

Sequences (6+)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 1 potential isoform that is computationally mapped.iShow all

Isoform 1 (identifier: A6NNP5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKEERNYNFD GVSTNRLKQQ LLEEVRKKDA VQLSIFELRH KITELEAKLN
60 70 80 90 100
TDNEGSEWKT RYETQLELND ELEKQIVYLK EKVEKIHGNS SDRLSSIRVY
110 120 130 140 150
ERMPVESLNT LLKQLEEEKK TLESQVKYYA LKLEQESKAY QKINNERRTY
160 170 180 190 200
LAEMSQGSGL HQVSKRQQVD QLPRMQENLV KTGRYNPAKQ KTVSAKRGPV
210
KKITRPNHLP ELHP
Length:214
Mass (Da):25,253
Last modified:January 11, 2011 - v4
Checksum:iDB509F614FFB574B
GO
Isoform 2 (identifier: A6NNP5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     106-115: ESLNTLLKQL → VSRNVIKHKE
     116-214: Missing.

Note: No experimental confirmation available.
Show »
Length:115
Mass (Da):13,763
Checksum:i02238FB20BEA8F4F
GO
Isoform 3 (identifier: A6NNP5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-102: Missing.
     183-214: GRYNPAKQKTVSAKRGPVKKITRPNHLPELHP → LLLKEELDPL...LAVCQTHLKS

Show »
Length:139
Mass (Da):15,615
Checksum:i3EAE1A6B883708BF
GO
Isoform 4 (identifier: A6NNP5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     183-214: GRYNPAKQKTVSAKRGPVKKITRPNHLPELHP → LLLKEELDPL...LAVCQTHLKS

Show »
Length:241
Mass (Da):27,841
Checksum:iCC366826415447CE
GO
Isoform 5 (identifier: A6NNP5-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-102: Missing.

Show »
Length:112
Mass (Da):13,027
Checksum:iB235545E12A69B7B
GO
Isoform 6 (identifier: A6NNP5-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-100: Missing.
     101-105: ERMPV → METLQ
     183-214: GRYNPAKQKTVSAKRGPVKKITRPNHLPELHP → LLLKEELDPL...LAVCQTHLKS

Show »
Length:141
Mass (Da):15,890
Checksum:i7EFDC84561677046
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PBZ7E9PBZ7_HUMAN
Coiled-coil domain-containing prote...
CCDC169
91Annotation score:

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_057811120K → R. Corresponds to variant dbSNP:rs9546897Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0404791 – 102Missing in isoform 3 and isoform 5. 2 PublicationsAdd BLAST102
Alternative sequenceiVSP_0438101 – 100Missing in isoform 6. 1 PublicationAdd BLAST100
Alternative sequenceiVSP_043811101 – 105ERMPV → METLQ in isoform 6. 1 Publication5
Alternative sequenceiVSP_035636106 – 115ESLNTLLKQL → VSRNVIKHKE in isoform 2. Curated10
Alternative sequenceiVSP_035637116 – 214Missing in isoform 2. CuratedAdd BLAST99
Alternative sequenceiVSP_040480183 – 214GRYNP…PELHP → LLLKEELDPLKVSCLETLGF SAAGVAGPENRTCLGQKALW PACLHGSSTLAVCQTHLKS in isoform 3, isoform 4 and isoform 6. 1 PublicationAdd BLAST32

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK308999 mRNA No translation available.
AL139377 Genomic DNA No translation available.
BC146975 mRNA Translation: AAI46976.1
BC171867 mRNA Translation: AAI71867.1
BC171872 mRNA Translation: AAI71872.1
BC171874 mRNA Translation: AAI71874.1
BC171880 mRNA Translation: AAI71880.1
BC171881 mRNA Translation: AAI71881.1
BC171882 mRNA Translation: AAI71882.1
CCDSiCCDS45027.1 [A6NNP5-3]
CCDS45028.1 [A6NNP5-1]
CCDS45029.1 [A6NNP5-5]
CCDS53863.1 [A6NNP5-6]
CCDS55897.1 [A6NNP5-4]
RefSeqiNP_001138453.1, NM_001144981.2 [A6NNP5-1]
NP_001138454.1, NM_001144982.2 [A6NNP5-3]
NP_001138455.1, NM_001144983.2 [A6NNP5-3]
NP_001138456.1, NM_001144984.2 [A6NNP5-6]
NP_001138457.1, NM_001144985.2 [A6NNP5-5]
NP_001138458.1, NM_001144986.2 [A6NNP5-5]
NP_001185837.1, NM_001198908.1 [A6NNP5-4]
UniGeneiHs.656745
Hs.730899

Genome annotation databases

EnsembliENST00000239859; ENSP00000239859; ENSG00000242715 [A6NNP5-1]
ENST00000239860; ENSP00000239860; ENSG00000242715 [A6NNP5-6]
ENST00000379862; ENSP00000369191; ENSG00000242715 [A6NNP5-5]
ENST00000379864; ENSP00000369193; ENSG00000242715 [A6NNP5-3]
ENST00000491049; ENSP00000425252; ENSG00000242715 [A6NNP5-3]
ENST00000503173; ENSP00000426174; ENSG00000242715 [A6NNP5-4]
ENST00000510088; ENSP00000427495; ENSG00000242715 [A6NNP5-5]
GeneIDi728591
KEGGihsa:728591
UCSCiuc010abm.4 human [A6NNP5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK308999 mRNA No translation available.
AL139377 Genomic DNA No translation available.
BC146975 mRNA Translation: AAI46976.1
BC171867 mRNA Translation: AAI71867.1
BC171872 mRNA Translation: AAI71872.1
BC171874 mRNA Translation: AAI71874.1
BC171880 mRNA Translation: AAI71880.1
BC171881 mRNA Translation: AAI71881.1
BC171882 mRNA Translation: AAI71882.1
CCDSiCCDS45027.1 [A6NNP5-3]
CCDS45028.1 [A6NNP5-1]
CCDS45029.1 [A6NNP5-5]
CCDS53863.1 [A6NNP5-6]
CCDS55897.1 [A6NNP5-4]
RefSeqiNP_001138453.1, NM_001144981.2 [A6NNP5-1]
NP_001138454.1, NM_001144982.2 [A6NNP5-3]
NP_001138455.1, NM_001144983.2 [A6NNP5-3]
NP_001138456.1, NM_001144984.2 [A6NNP5-6]
NP_001138457.1, NM_001144985.2 [A6NNP5-5]
NP_001138458.1, NM_001144986.2 [A6NNP5-5]
NP_001185837.1, NM_001198908.1 [A6NNP5-4]
UniGeneiHs.656745
Hs.730899

3D structure databases

ProteinModelPortaliA6NNP5
SMRiA6NNP5
ModBaseiSearch...
MobiDBiSearch...

PTM databases

iPTMnetiA6NNP5
PhosphoSitePlusiA6NNP5

Polymorphism and mutation databases

BioMutaiCCDC169

Proteomic databases

PaxDbiA6NNP5
PRIDEiA6NNP5
ProteomicsDBi1625
1626 [A6NNP5-2]
1627 [A6NNP5-3]
1628 [A6NNP5-4]
1629 [A6NNP5-5]
1630 [A6NNP5-6]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000239859; ENSP00000239859; ENSG00000242715 [A6NNP5-1]
ENST00000239860; ENSP00000239860; ENSG00000242715 [A6NNP5-6]
ENST00000379862; ENSP00000369191; ENSG00000242715 [A6NNP5-5]
ENST00000379864; ENSP00000369193; ENSG00000242715 [A6NNP5-3]
ENST00000491049; ENSP00000425252; ENSG00000242715 [A6NNP5-3]
ENST00000503173; ENSP00000426174; ENSG00000242715 [A6NNP5-4]
ENST00000510088; ENSP00000427495; ENSG00000242715 [A6NNP5-5]
GeneIDi728591
KEGGihsa:728591
UCSCiuc010abm.4 human [A6NNP5-1]

Organism-specific databases

CTDi728591
EuPathDBiHostDB:ENSG00000242715.7
GeneCardsiCCDC169
HGNCiHGNC:34361 CCDC169
neXtProtiNX_A6NNP5
OpenTargetsiENSG00000242715
PharmGKBiPA162378105
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IWC3 Eukaryota
ENOG4111UKE LUCA
GeneTreeiENSGT00390000011174
HOGENOMiHOG000082544
HOVERGENiHBG090707
InParanoidiA6NNP5
OMAiEIHMKDL
OrthoDBiEOG091G0OFA
PhylomeDBiA6NNP5
TreeFamiTF329642

Miscellaneous databases

GenomeRNAii728591
PROiPR:A6NNP5

Gene expression databases

BgeeiENSG00000242715 Expressed in 94 organ(s), highest expression level in sperm
ExpressionAtlasiA6NNP5 baseline and differential
GenevisibleiA6NNP5 HS

Family and domain databases

InterProiView protein in InterPro
IPR028022 DUF4600
PANTHERiPTHR28671 PTHR28671, 1 hit
PfamiView protein in Pfam
PF15372 DUF4600, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiCC169_HUMAN
AccessioniPrimary (citable) accession number: A6NNP5
Secondary accession number(s): A6NC13
, A6NCT2, B7ZW45, B7ZW49, B9EJF2, Q9H1T4, Q9H1T5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 10, 2008
Last sequence update: January 11, 2011
Last modified: September 12, 2018
This is version 78 of the entry and version 4 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again