Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 92 (10 Feb 2021)
Sequence version 4 (11 Jan 2011)
Previous versions | rss
Add a publicationFeedback
Protein

Coiled-coil domain-containing protein 169

Gene

CCDC169

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
A6NNP5

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Coiled-coil domain-containing protein 169
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CCDC169
Synonyms:C13orf38
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 13

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:34361, CCDC169

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_A6NNP5

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000242715.7

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000242715

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162378105

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
A6NNP5, Tdark

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CCDC169

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003413661 – 214Coiled-coil domain-containing protein 169Add BLAST214

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
A6NNP5

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
A6NNP5

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
A6NNP5

PeptideAtlas

More...
PeptideAtlasi
A6NNP5

PRoteomics IDEntifications database

More...
PRIDEi
A6NNP5

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
1625 [A6NNP5-1]
1626 [A6NNP5-2]
1627 [A6NNP5-3]
1628 [A6NNP5-4]
1629 [A6NNP5-5]
1630 [A6NNP5-6]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
A6NNP5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
A6NNP5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000242715, Expressed in sperm and 118 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
A6NNP5, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
A6NNP5, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000242715, Tissue enriched (testis)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
609013, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000426174

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
A6NNP5, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
A6NNP5

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili29 – 154Sequence analysisAdd BLAST126

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the CCDC169 family.Curated

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502S1I0, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000011174

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_2090285_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
A6NNP5

Identification of Orthologs from Complete Genome Data

More...
OMAi
YERMSVE

Database of Orthologous Groups

More...
OrthoDBi
1431259at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
A6NNP5

TreeFam database of animal gene trees

More...
TreeFami
TF329642

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR028022, DUF4600

The PANTHER Classification System

More...
PANTHERi
PTHR28671, PTHR28671, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF15372, DUF4600, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: A6NNP5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKEERNYNFD GVSTNRLKQQ LLEEVRKKDA VQLSIFELRH KITELEAKLN
60 70 80 90 100
TDNEGSEWKT RYETQLELND ELEKQIVYLK EKVEKIHGNS SDRLSSIRVY
110 120 130 140 150
ERMPVESLNT LLKQLEEEKK TLESQVKYYA LKLEQESKAY QKINNERRTY
160 170 180 190 200
LAEMSQGSGL HQVSKRQQVD QLPRMQENLV KTGRYNPAKQ KTVSAKRGPV
210
KKITRPNHLP ELHP
Length:214
Mass (Da):25,253
Last modified:January 11, 2011 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDB509F614FFB574B
GO
Isoform 2 (identifier: A6NNP5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     106-115: ESLNTLLKQL → VSRNVIKHKE
     116-214: Missing.

Show »
Length:115
Mass (Da):13,763
Checksum:i02238FB20BEA8F4F
GO
Isoform 3 (identifier: A6NNP5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-102: Missing.
     183-214: GRYNPAKQKTVSAKRGPVKKITRPNHLPELHP → LLLKEELDPL...LAVCQTHLKS

Show »
Length:139
Mass (Da):15,615
Checksum:i3EAE1A6B883708BF
GO
Isoform 4 (identifier: A6NNP5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     183-214: GRYNPAKQKTVSAKRGPVKKITRPNHLPELHP → LLLKEELDPL...LAVCQTHLKS

Show »
Length:241
Mass (Da):27,841
Checksum:iCC366826415447CE
GO
Isoform 5 (identifier: A6NNP5-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-102: Missing.

Show »
Length:112
Mass (Da):13,027
Checksum:iB235545E12A69B7B
GO
Isoform 6 (identifier: A6NNP5-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-100: Missing.
     101-105: ERMPV → METLQ
     183-214: GRYNPAKQKTVSAKRGPVKKITRPNHLPELHP → LLLKEELDPL...LAVCQTHLKS

Show »
Length:141
Mass (Da):15,890
Checksum:i7EFDC84561677046
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PBZ7E9PBZ7_HUMAN
Coiled-coil domain-containing prote...
CCDC169
91Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_057811120K → R. Corresponds to variant dbSNP:rs9546897Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0404791 – 102Missing in isoform 3 and isoform 5. 2 PublicationsAdd BLAST102
Alternative sequenceiVSP_0438101 – 100Missing in isoform 6. 1 PublicationAdd BLAST100
Alternative sequenceiVSP_043811101 – 105ERMPV → METLQ in isoform 6. 1 Publication5
Alternative sequenceiVSP_035636106 – 115ESLNTLLKQL → VSRNVIKHKE in isoform 2. Curated10
Alternative sequenceiVSP_035637116 – 214Missing in isoform 2. CuratedAdd BLAST99
Alternative sequenceiVSP_040480183 – 214GRYNP…PELHP → LLLKEELDPLKVSCLETLGF SAAGVAGPENRTCLGQKALW PACLHGSSTLAVCQTHLKS in isoform 3, isoform 4 and isoform 6. 1 PublicationAdd BLAST32

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK308999 mRNA No translation available.
AL139377 Genomic DNA No translation available.
BC146975 mRNA Translation: AAI46976.1
BC171867 mRNA Translation: AAI71867.1
BC171872 mRNA Translation: AAI71872.1
BC171874 mRNA Translation: AAI71874.1
BC171880 mRNA Translation: AAI71880.1
BC171881 mRNA Translation: AAI71881.1
BC171882 mRNA Translation: AAI71882.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS45027.1 [A6NNP5-3]
CCDS45028.1 [A6NNP5-1]
CCDS45029.1 [A6NNP5-5]
CCDS53863.1 [A6NNP5-6]
CCDS55897.1 [A6NNP5-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001138453.1, NM_001144981.2 [A6NNP5-1]
NP_001138454.1, NM_001144982.2 [A6NNP5-3]
NP_001138455.1, NM_001144983.2 [A6NNP5-3]
NP_001138456.1, NM_001144984.2 [A6NNP5-6]
NP_001138457.1, NM_001144985.2 [A6NNP5-5]
NP_001138458.1, NM_001144986.2 [A6NNP5-5]
NP_001185837.1, NM_001198908.1 [A6NNP5-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000239859; ENSP00000239859; ENSG00000242715 [A6NNP5-1]
ENST00000239860; ENSP00000239860; ENSG00000242715 [A6NNP5-6]
ENST00000379862; ENSP00000369191; ENSG00000242715 [A6NNP5-5]
ENST00000379864; ENSP00000369193; ENSG00000242715 [A6NNP5-3]
ENST00000491049; ENSP00000425252; ENSG00000242715 [A6NNP5-3]
ENST00000503173; ENSP00000426174; ENSG00000242715 [A6NNP5-4]
ENST00000510088; ENSP00000427495; ENSG00000242715 [A6NNP5-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
728591

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:728591

UCSC genome browser

More...
UCSCi
uc010abm.4, human [A6NNP5-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK308999 mRNA No translation available.
AL139377 Genomic DNA No translation available.
BC146975 mRNA Translation: AAI46976.1
BC171867 mRNA Translation: AAI71867.1
BC171872 mRNA Translation: AAI71872.1
BC171874 mRNA Translation: AAI71874.1
BC171880 mRNA Translation: AAI71880.1
BC171881 mRNA Translation: AAI71881.1
BC171882 mRNA Translation: AAI71882.1
CCDSiCCDS45027.1 [A6NNP5-3]
CCDS45028.1 [A6NNP5-1]
CCDS45029.1 [A6NNP5-5]
CCDS53863.1 [A6NNP5-6]
CCDS55897.1 [A6NNP5-4]
RefSeqiNP_001138453.1, NM_001144981.2 [A6NNP5-1]
NP_001138454.1, NM_001144982.2 [A6NNP5-3]
NP_001138455.1, NM_001144983.2 [A6NNP5-3]
NP_001138456.1, NM_001144984.2 [A6NNP5-6]
NP_001138457.1, NM_001144985.2 [A6NNP5-5]
NP_001138458.1, NM_001144986.2 [A6NNP5-5]
NP_001185837.1, NM_001198908.1 [A6NNP5-4]

3D structure databases

SMRiA6NNP5
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi609013, 1 interactor
STRINGi9606.ENSP00000426174

PTM databases

iPTMnetiA6NNP5
PhosphoSitePlusiA6NNP5

Genetic variation databases

BioMutaiCCDC169

Proteomic databases

jPOSTiA6NNP5
MassIVEiA6NNP5
PaxDbiA6NNP5
PeptideAtlasiA6NNP5
PRIDEiA6NNP5
ProteomicsDBi1625 [A6NNP5-1]
1626 [A6NNP5-2]
1627 [A6NNP5-3]
1628 [A6NNP5-4]
1629 [A6NNP5-5]
1630 [A6NNP5-6]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
52943, 14 antibodies

Genome annotation databases

EnsembliENST00000239859; ENSP00000239859; ENSG00000242715 [A6NNP5-1]
ENST00000239860; ENSP00000239860; ENSG00000242715 [A6NNP5-6]
ENST00000379862; ENSP00000369191; ENSG00000242715 [A6NNP5-5]
ENST00000379864; ENSP00000369193; ENSG00000242715 [A6NNP5-3]
ENST00000491049; ENSP00000425252; ENSG00000242715 [A6NNP5-3]
ENST00000503173; ENSP00000426174; ENSG00000242715 [A6NNP5-4]
ENST00000510088; ENSP00000427495; ENSG00000242715 [A6NNP5-5]
GeneIDi728591
KEGGihsa:728591
UCSCiuc010abm.4, human [A6NNP5-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
728591

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CCDC169
HGNCiHGNC:34361, CCDC169
HPAiENSG00000242715, Tissue enriched (testis)
neXtProtiNX_A6NNP5
OpenTargetsiENSG00000242715
PharmGKBiPA162378105
VEuPathDBiHostDB:ENSG00000242715.7

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG502S1I0, Eukaryota
GeneTreeiENSGT00390000011174
HOGENOMiCLU_2090285_0_0_1
InParanoidiA6NNP5
OMAiYERMSVE
OrthoDBi1431259at2759
PhylomeDBiA6NNP5
TreeFamiTF329642

Enzyme and pathway databases

PathwayCommonsiA6NNP5

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
728591, 20 hits in 879 CRISPR screens

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
728591
PharosiA6NNP5, Tdark

Protein Ontology

More...
PROi
PR:A6NNP5
RNActiA6NNP5, protein

Gene expression databases

BgeeiENSG00000242715, Expressed in sperm and 118 other tissues
ExpressionAtlasiA6NNP5, baseline and differential
GenevisibleiA6NNP5, HS

Family and domain databases

InterProiView protein in InterPro
IPR028022, DUF4600
PANTHERiPTHR28671, PTHR28671, 1 hit
PfamiView protein in Pfam
PF15372, DUF4600, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCC169_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A6NNP5
Secondary accession number(s): A6NC13
, A6NCT2, B7ZW45, B7ZW49, B9EJF2, Q9H1T4, Q9H1T5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 10, 2008
Last sequence update: January 11, 2011
Last modified: February 10, 2021
This is version 92 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Uncharacterized protein families (UPF)
    List of uncharacterized protein family (UPF) entries
  2. Human chromosome 13
    Human chromosome 13: entries, gene names and cross-references to MIM
  3. Human entries with genetic variants
    List of human entries with genetic variants
  4. Human variants curated from literature reports
    Index of human variants curated from literature reports
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again