Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 92 (13 Feb 2019)
Sequence version 3 (20 May 2008)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Pecanex-like protein 2

Gene

PCNX2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May play a role in tumorigenesis of colorectal carcinomas with high microsatellite instability (MSI-H).2 Publications

Miscellaneous

PCNXL2 is characterized by high mutational frequencies and biallelic mutations in MSI-H colorectal tumors, and is thus likely to be a target gene in these tumors.

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Pecanex-like protein 2
Alternative name(s):
Pecanex homolog protein 2Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PCNX2Imported
Synonyms:KIAA0435, PCNXL2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000135749.18

Human Gene Nomenclature Database

More...
HGNCi
HGNC:8736 PCNX2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
617656 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_A6NKB5

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei34 – 54HelicalSequence analysisAdd BLAST21
Transmembranei57 – 77HelicalSequence analysisAdd BLAST21
Transmembranei844 – 864HelicalSequence analysisAdd BLAST21
Transmembranei868 – 888HelicalSequence analysisAdd BLAST21
Transmembranei901 – 921HelicalSequence analysisAdd BLAST21
Transmembranei952 – 972HelicalSequence analysisAdd BLAST21
Transmembranei983 – 1003HelicalSequence analysisAdd BLAST21
Transmembranei1029 – 1049HelicalSequence analysisAdd BLAST21
Transmembranei1099 – 1119HelicalSequence analysisAdd BLAST21
Transmembranei1124 – 1144HelicalSequence analysisAdd BLAST21
Transmembranei1193 – 1213HelicalSequence analysisAdd BLAST21
Transmembranei1237 – 1257HelicalSequence analysisAdd BLAST21
Transmembranei1265 – 1285HelicalSequence analysisAdd BLAST21
Transmembranei1302 – 1322HelicalSequence analysisAdd BLAST21
Transmembranei1324 – 1344HelicalSequence analysisAdd BLAST21

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
80003

Open Targets

More...
OpenTargetsi
ENSG00000135749

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA33081

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PCNX2

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003339651 – 2137Pecanex-like protein 2Add BLAST2137

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi136N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi449N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi550N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi572N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi587N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi598N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi613N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1412N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1553N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1818N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi2054N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
A6NKB5

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
A6NKB5

PRoteomics IDEntifications database

More...
PRIDEi
A6NKB5

ProteomicsDB human proteome resource

More...
ProteomicsDBi
1391
1392 [A6NKB5-2]
1393 [A6NKB5-3]
1394 [A6NKB5-4]
1395 [A6NKB5-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
A6NKB5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
A6NKB5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000135749 Expressed in 215 organ(s), highest expression level in middle temporal gyrus

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
A6NKB5 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
A6NKB5 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA013815
HPA014427

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
123060, 3 interactors

Protein interaction database and analysis system

More...
IntActi
A6NKB5, 2 interactors

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
A6NKB5

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi1937 – 2063Ser-richAdd BLAST127

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the pecanex family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3604 Eukaryota
ENOG4111D2H LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157374

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG108237

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
A6NKB5

Identification of Orthologs from Complete Genome Data

More...
OMAi
FYCSSVT

Database of Orthologous Groups

More...
OrthoDBi
63639at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
A6NKB5

TreeFam database of animal gene trees

More...
TreeFami
TF313570

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR039797 Pecanex
IPR007735 Pecanex_C

The PANTHER Classification System

More...
PANTHERi
PTHR12372 PTHR12372, 4 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF05041 Pecanex_C, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: A6NKB5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVSQVLQLLR QGVWAALTGG WYHDPEQSKF TNSCHLYLWL FLLLLPLALH
60 70 80 90 100
LAFPPNAIIV FFYCSAVTIF FTIIKLVSYR LHLMFDKGEV IQQKPSRKEE
110 120 130 140 150
KPNKDKEAKG EHITNHRNPS NNRQIHNGKK EEASRNLSTP PLRCSSRGQS
160 170 180 190 200
ITSHHSSGPL ELSAQETVED LKGVILLEDH PIAPVSSTSP GIKVESLPAS
210 220 230 240 250
QAHMLETTTK SVIPVKPVAT ETLINGKGKE RGGKGQPPLR HRSEGGLVDK
260 270 280 290 300
GPLKKLPHLS LSQYDLLETD VSFQPWGSEN SVLIPEPVSC PRGSIRERVQ
310 320 330 340 350
SKSPQDSLSS SCPQCDTIVA KPVEEPADTS CQVDTSCQGD LPLHQEVDSS
360 370 380 390 400
DSEVAVTLID TSQPGDPLSL HEPIKIVITM SSTPNSMTDL ESSLHLRVVG
410 420 430 440 450
TEKTSVKSDA EPTNPGAAGS PNAEQISIPV ITLDLPEGGG GGVPCPEGNG
460 470 480 490 500
SERTPERLKT RVSTNQCSGY GSGEGGNAIK DHSSSSREPW ESVSRLTPDT
510 520 530 540 550
GSESKVGKEG QTNLDPSSCK SSHEKRHARV LSVDSGTDVF LSKSSAEIVN
560 570 580 590 600
DTEKTMPTSK SDLEAKEGQM PNESNFLEFV SLLESINTSK MTASSQLNGS
610 620 630 640 650
AEQNEESGLL RDNCSQEKKE EILENEKPSG HSSKQGKPDL QSQDHTSTGP
660 670 680 690 700
ACTQPAKTTA FFQGNRQRQI IYRVTSQQDS SVLQVISGPE TSVQEEISVD
710 720 730 740 750
AMHVFIDEHG EIRSCYLKSG NQKEGPLQPL PSNNDCLSQA REMQVSSSST
760 770 780 790 800
TTSESQDPSS GDPAVSALQQ QLLLMVARRT QSETPRHVSQ DLEASSCSST
810 820 830 840 850
QGKFNREQFY KFIIFPGKWI KVWYDRLTLL ALLDRTEDIK ENVLAILLIV
860 870 880 890 900
LVSLLGFLTL SQGFCKDMWV LLFCLVMASC QYSLLKSVQP DPASPIHGHN
910 920 930 940 950
QIITYSRPIY FCVLCGLILL LDTGAKARHP PSYVVYGLKL FSPVFLQSAR
960 970 980 990 1000
DYLIVFLYCF PAISLLGLFP QINTFCTYLL EQIDMLFFGG SAVSGITSAV
1010 1020 1030 1040 1050
YSVARSVLAA ALLHAVCFSA VKEPWSMQHI PALFSAFCGL LVALSYHLSR
1060 1070 1080 1090 1100
QSSDPSVLMS FIQCRLFPKF LHQNLAESAA DPLPKKMKDS VTDVLKWDLI
1110 1120 1130 1140 1150
VCAVVAVLSF AVSASTVFLS LRPFLSIVLF ALAGAVGFVT HYVLPQLRKH
1160 1170 1180 1190 1200
HPWMWISHPI LKNKEYHQRE VRDVAHLMWF ERLYVWLQCF EKYILYPALI
1210 1220 1230 1240 1250
LNALTIDAFL ISNHRRLGTH WDIFLMIIAG MKLLRTSFCN PVYQFINLSF
1260 1270 1280 1290 1300
TVIFFHFDYK DISESFLLDF FMVSILFSKL GDLLHKLQFV LTYVAPWQMA
1310 1320 1330 1340 1350
WGSSFHVFAQ LFAIPHSAML FFQTIATSIF STPLSPFLGS VIFITSYVRP
1360 1370 1380 1390 1400
VKFWEKNYNT RRVDNSNTRL AVQIERDPGN DDNNLNSIFY EHLTRTLQES
1410 1420 1430 1440 1450
LCGDLVLGRW GNYSSGDCFI LASDDLNAFV HLIEIGNGLV TFQLRGLEFR
1460 1470 1480 1490 1500
GTYCQQREVE AIMEGDEEDR GCCCCKPGHL PHLLSCNAAF HLRWLTWEIT
1510 1520 1530 1540 1550
QTQYILEGYS ILDNNAATML QVFDLRRILI RYYIKSIIYY MVTSPKLLSW
1560 1570 1580 1590 1600
IKNESLLKSL QPFAKWHYIE RDLAMFNINI DDDYVPCLQG ITRASFCNVY
1610 1620 1630 1640 1650
LEWIQHCARK RQEPSTTLDS DEDSPLVTLS FALCTLGRRA LGTAAHNMAI
1660 1670 1680 1690 1700
SLDSFLYGLH VLFKGDFRIT ARDEWVFADM DLLHKVVAPA IRMSLKLHQD
1710 1720 1730 1740 1750
QFTCPDEYED PAVLYEAIQS FEKKVVICHE GDPAWRGAVL SNKEELLTLR
1760 1770 1780 1790 1800
HVVDEGADEY KVIMLHRSFL SFKVIKVNKE CVRGLWAGQQ QELIFLRNRN
1810 1820 1830 1840 1850
PERGSIQNNK QVLRNLINSS CDQPLGYPMY VSPLTTSYLG THRQLKNIWG
1860 1870 1880 1890 1900
GPITLDRIRT WFWTKWVRMR KDCNARQHSG GNIEDVDGGG APTTGGNNAP
1910 1920 1930 1940 1950
SGGSQESSAE QPRKGGAQHG VSSCEGTQRT GRRKGRSQSV QAHSALSQRP
1960 1970 1980 1990 2000
PMLSSSGPIL ESRQTFLQTS TSVHELAQRL SGSRLSLHAS ATSLHSQPPP
2010 2020 2030 2040 2050
VTTTGHLSVR ERAEALIRSS LGSSTSSTLS FLFGKRSFSS ALVISGLSAA
2060 2070 2080 2090 2100
EGGNTSDTQS SSSVNIVMGP SARAASQATR HLSEPCEPPD ATEQGQLHDR
2110 2120 2130
CLAEAVADTL GVVCRRASQE DMGLDDTASQ QSVSDEQ
Length:2,137
Mass (Da):237,277
Last modified:May 20, 2008 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i064D91B62BF84E44
GO
Isoform 2 (identifier: A6NKB5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-701: Missing.
     955-987: VFLYCFPAISLLGLFPQINTFCTYLLEQIDMLF → GKIMNSHKDFFTSEKKKDKIISAISSVIFLKSW
     988-2137: Missing.

Show »
Length:286
Mass (Da):32,206
Checksum:i6C2E4681ED159F22
GO
Isoform 3 (identifier: A6NKB5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1348: Missing.
     1349-1359: RPVKFWEKNYN → MTFYPFVASSS
     2081-2137: HLSEPCEPPD...ASQQSVSDEQ → VRGWAGLTRT...PIPFSMGLPE

Note: No experimental confirmation available.
Show »
Length:777
Mass (Da):86,628
Checksum:i35E12F71B1BCE69E
GO
Isoform 5 (identifier: A6NKB5-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-867: Missing.
     1280-1288: LGDLLHKLQ → VFLGYVRQK
     1289-2137: Missing.

Show »
Length:421
Mass (Da):48,009
Checksum:iD6C30F9210A8A1C8
GO
Isoform 4 (identifier: A6NKB5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1462: Missing.

Note: No experimental confirmation available.
Show »
Length:675
Mass (Da):75,024
Checksum:i80B564005A8ED96E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E7EVZ6E7EVZ6_HUMAN
Pecanex-like protein 2
PCNX2
424Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MSK9A0A0A0MSK9_HUMAN
Pecanex-like protein 2
PCNX2
412Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YB15H0YB15_HUMAN
Pecanex-like protein 2
PCNX2
490Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YAR6H0YAR6_HUMAN
Pecanex-like protein 2
PCNX2
109Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YAV6H0YAV6_HUMAN
Pecanex-like protein 2
PCNX2
178Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YB30H0YB30_HUMAN
Pecanex-like protein 2
PCNX2
47Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YBD1H0YBD1_HUMAN
Pecanex-like protein 2
PCNX2
181Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YBD6H0YBD6_HUMAN
Pecanex-like protein 2
PCNX2
45Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YBF4H0YBF4_HUMAN
Pecanex-like protein 2
PCNX2
218Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA23708 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB84904 differs from that shown. Reason: Erroneous initiation.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_050479117R → K. Corresponds to variant dbSNP:rs1033325Ensembl.1
Natural variantiVAR_043341454T → A. Corresponds to variant dbSNP:rs10910120Ensembl.1
Natural variantiVAR_0614981901S → N1 PublicationCorresponds to variant dbSNP:rs56231757Ensembl.1
Natural variantiVAR_0614991984R → Q. Corresponds to variant dbSNP:rs41309639Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0336051 – 1462Missing in isoform 4. 1 PublicationAdd BLAST1462
Alternative sequenceiVSP_0336061 – 1348Missing in isoform 3. 1 PublicationAdd BLAST1348
Alternative sequenceiVSP_0350481 – 867Missing in isoform 5. 1 PublicationAdd BLAST867
Alternative sequenceiVSP_0336071 – 701Missing in isoform 2. 1 PublicationAdd BLAST701
Alternative sequenceiVSP_033608955 – 987VFLYC…IDMLF → GKIMNSHKDFFTSEKKKDKI ISAISSVIFLKSW in isoform 2. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_033609988 – 2137Missing in isoform 2. 1 PublicationAdd BLAST1150
Alternative sequenceiVSP_0350491280 – 1288LGDLLHKLQ → VFLGYVRQK in isoform 5. 1 Publication9
Alternative sequenceiVSP_0350501289 – 2137Missing in isoform 5. 1 PublicationAdd BLAST849
Alternative sequenceiVSP_0336101349 – 1359RPVKFWEKNYN → MTFYPFVASSS in isoform 3. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_0336112081 – 2137HLSEP…VSDEQ → VRGWAGLTRTGWDGGTGSWP ERGTCLAFPPFCLQNPIPFS MGLPE in isoform 3. 1 PublicationAdd BLAST57

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB007895 mRNA Translation: BAA23708.2 Different initiation.
AK074078 mRNA Translation: BAB84904.1 Different initiation.
AK021445 mRNA Translation: BAB13826.1
AL139342, AL122003, AL133289 Genomic DNA Translation: CAI18866.1
AL133291 Genomic DNA No translation available.
AL133380 Genomic DNA No translation available.
AL139342 Genomic DNA Translation: CAI18867.1
AL122003, AL139342, AL133289 Genomic DNA Translation: CAI22240.1
AL122003, AL133289 Genomic DNA Translation: CAI22241.1
AL133289, AL139342, AL122003 Genomic DNA Translation: CAI22872.1
AL133289, AL122003 Genomic DNA Translation: CAI22873.1
AL359819 Genomic DNA No translation available.
BC008300 mRNA Translation: AAH08300.2

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS44335.1 [A6NKB5-1]

NCBI Reference Sequences

More...
RefSeqi
NP_055616.3, NM_014801.3 [A6NKB5-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.370605

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000258229; ENSP00000258229; ENSG00000135749 [A6NKB5-1]
ENST00000344698; ENSP00000340759; ENSG00000135749 [A6NKB5-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
80003

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:80003

UCSC genome browser

More...
UCSCi
uc001hvk.1 human [A6NKB5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB007895 mRNA Translation: BAA23708.2 Different initiation.
AK074078 mRNA Translation: BAB84904.1 Different initiation.
AK021445 mRNA Translation: BAB13826.1
AL139342, AL122003, AL133289 Genomic DNA Translation: CAI18866.1
AL133291 Genomic DNA No translation available.
AL133380 Genomic DNA No translation available.
AL139342 Genomic DNA Translation: CAI18867.1
AL122003, AL139342, AL133289 Genomic DNA Translation: CAI22240.1
AL122003, AL133289 Genomic DNA Translation: CAI22241.1
AL133289, AL139342, AL122003 Genomic DNA Translation: CAI22872.1
AL133289, AL122003 Genomic DNA Translation: CAI22873.1
AL359819 Genomic DNA No translation available.
BC008300 mRNA Translation: AAH08300.2
CCDSiCCDS44335.1 [A6NKB5-1]
RefSeqiNP_055616.3, NM_014801.3 [A6NKB5-1]
UniGeneiHs.370605

3D structure databases

ProteinModelPortaliA6NKB5
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123060, 3 interactors
IntActiA6NKB5, 2 interactors

PTM databases

iPTMnetiA6NKB5
PhosphoSitePlusiA6NKB5

Polymorphism and mutation databases

BioMutaiPCNX2

Proteomic databases

jPOSTiA6NKB5
PaxDbiA6NKB5
PRIDEiA6NKB5
ProteomicsDBi1391
1392 [A6NKB5-2]
1393 [A6NKB5-3]
1394 [A6NKB5-4]
1395 [A6NKB5-5]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000258229; ENSP00000258229; ENSG00000135749 [A6NKB5-1]
ENST00000344698; ENSP00000340759; ENSG00000135749 [A6NKB5-3]
GeneIDi80003
KEGGihsa:80003
UCSCiuc001hvk.1 human [A6NKB5-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
80003
DisGeNETi80003
EuPathDBiHostDB:ENSG00000135749.18

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PCNX2

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0001704
HGNCiHGNC:8736 PCNX2
HPAiHPA013815
HPA014427
MIMi617656 gene
neXtProtiNX_A6NKB5
OpenTargetsiENSG00000135749
PharmGKBiPA33081

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3604 Eukaryota
ENOG4111D2H LUCA
GeneTreeiENSGT00940000157374
HOVERGENiHBG108237
InParanoidiA6NKB5
OMAiFYCSSVT
OrthoDBi63639at2759
PhylomeDBiA6NKB5
TreeFamiTF313570

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PCNX2 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
80003

Protein Ontology

More...
PROi
PR:A6NKB5

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000135749 Expressed in 215 organ(s), highest expression level in middle temporal gyrus
ExpressionAtlasiA6NKB5 baseline and differential
GenevisibleiA6NKB5 HS

Family and domain databases

InterProiView protein in InterPro
IPR039797 Pecanex
IPR007735 Pecanex_C
PANTHERiPTHR12372 PTHR12372, 4 hits
PfamiView protein in Pfam
PF05041 Pecanex_C, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPCX2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A6NKB5
Secondary accession number(s): O43162
, Q5T9Z8, Q5TDF1, Q8TEP4, Q96HP9, Q9HAL8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: May 20, 2008
Last modified: February 13, 2019
This is version 92 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again