Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 85 (08 May 2019)
Sequence version 1 (24 Jul 2007)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Proline-rich protein 19

Gene

PRR19

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Proline-rich protein 19
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PRR19
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:33728 PRR19

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_A6NJB7

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000188368

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162400164

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PRR19

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003322731 – 356Proline-rich protein 19Add BLAST356

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
A6NJB7

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
A6NJB7

PRoteomics IDEntifications database

More...
PRIDEi
A6NJB7

ProteomicsDB human proteome resource

More...
ProteomicsDBi
1322
1323 [A6NJB7-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
A6NJB7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
A6NJB7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000188368 Expressed in 98 organ(s), highest expression level in right testis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
A6NJB7 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
A6NJB7 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA070350

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
129830, 2 interactors

Protein interaction database and analysis system

More...
IntActi
A6NJB7, 8 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000445247

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi240 – 334Pro-richAdd BLAST95

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IGDF Eukaryota
ENOG4111583 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000010703

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000060275

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
A6NJB7

Identification of Orthologs from Complete Genome Data

More...
OMAi
WGPPTAF

Database of Orthologous Groups

More...
OrthoDBi
1194731at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
A6NJB7

TreeFam database of animal gene trees

More...
TreeFami
TF341908

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR029355 Pro-rich_19

The PANTHER Classification System

More...
PANTHERi
PTHR37346 PTHR37346, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF15455 Pro-rich_19, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: A6NJB7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDTQGPVSQP FQQPEKPGRV RRRKTRRERN KALVGSRRPL AHHDPPVAIR
60 70 80 90 100
DPPVVPTASK LVVITQGRLS REHRGLFNHE VKSLDVARLL SSGTLVPGSP
110 120 130 140 150
TLPAKPSPSP GRAQEPAPRS RDKENQVPGG SGPGPPSSPE LSGVGQLLAE
160 170 180 190 200
LQCQLSLPQA FPRRNLIQDA RDAIVHTLQA CHGCVPDLAL VLRGCQPPLP
210 220 230 240 250
GAKPGVSERK MTPFWINSPD QVPEQERQRK QQGTKEFTFP MPYTSSMPTA
260 270 280 290 300
HRGSLAPPRG PWPPYFPSLS SPSGTAWGPP TAFDLLKSIW LVATPPPPRP
310 320 330 340 350
WGVGLPQPLP QPSSPLLPRT SVLDWSPSPP SPLPSLSWVV AQSSPEAWSF

PPMRLY
Length:356
Mass (Da):38,716
Last modified:July 24, 2007 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD14B1F45D366FD15
GO
Isoform 2 (identifier: A6NJB7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     202-356: AKPGVSERKM...AWSFPPMRLY → ERPSCPCTPLSFVGSSSASLYASFLCARGQAWGL

Show »
Length:235
Mass (Da):25,150
Checksum:i1D5FE856ED6E4D2F
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
M0QXP7M0QXP7_HUMAN
Proline-rich protein 19
PRR19
206Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti99S → N in BAF84217 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_033371202 – 356AKPGV…PMRLY → ERPSCPCTPLSFVGSSSASL YASFLCARGQAWGL in isoform 2. 2 PublicationsAdd BLAST155

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK124116 mRNA Translation: BAG54010.1
AK291528 mRNA Translation: BAF84217.1
AC006486 Genomic DNA No translation available.
BC063021 mRNA Translation: AAH63021.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS33036.1 [A6NJB7-1]

NCBI Reference Sequences

More...
RefSeqi
NP_954979.2, NM_199285.2 [A6NJB7-1]
XP_005258837.1, XM_005258780.3 [A6NJB7-1]
XP_006723217.1, XM_006723154.3 [A6NJB7-1]
XP_011525089.1, XM_011526787.1 [A6NJB7-1]
XP_011525090.1, XM_011526788.1 [A6NJB7-1]
XP_011525091.1, XM_011526789.2 [A6NJB7-1]
XP_011525092.1, XM_011526790.2 [A6NJB7-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000341747; ENSP00000342709; ENSG00000188368 [A6NJB7-1]
ENST00000499536; ENSP00000445247; ENSG00000188368 [A6NJB7-1]
ENST00000598490; ENSP00000472962; ENSG00000188368 [A6NJB7-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
284338

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:284338

UCSC genome browser

More...
UCSCi
uc002oth.2 human [A6NJB7-1]

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK124116 mRNA Translation: BAG54010.1
AK291528 mRNA Translation: BAF84217.1
AC006486 Genomic DNA No translation available.
BC063021 mRNA Translation: AAH63021.1
CCDSiCCDS33036.1 [A6NJB7-1]
RefSeqiNP_954979.2, NM_199285.2 [A6NJB7-1]
XP_005258837.1, XM_005258780.3 [A6NJB7-1]
XP_006723217.1, XM_006723154.3 [A6NJB7-1]
XP_011525089.1, XM_011526787.1 [A6NJB7-1]
XP_011525090.1, XM_011526788.1 [A6NJB7-1]
XP_011525091.1, XM_011526789.2 [A6NJB7-1]
XP_011525092.1, XM_011526790.2 [A6NJB7-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi129830, 2 interactors
IntActiA6NJB7, 8 interactors
STRINGi9606.ENSP00000445247

PTM databases

iPTMnetiA6NJB7
PhosphoSitePlusiA6NJB7

Polymorphism and mutation databases

BioMutaiPRR19

Proteomic databases

EPDiA6NJB7
PaxDbiA6NJB7
PRIDEiA6NJB7
ProteomicsDBi1322
1323 [A6NJB7-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
284338
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000341747; ENSP00000342709; ENSG00000188368 [A6NJB7-1]
ENST00000499536; ENSP00000445247; ENSG00000188368 [A6NJB7-1]
ENST00000598490; ENSP00000472962; ENSG00000188368 [A6NJB7-2]
GeneIDi284338
KEGGihsa:284338
UCSCiuc002oth.2 human [A6NJB7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
284338

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PRR19
HGNCiHGNC:33728 PRR19
HPAiHPA070350
neXtProtiNX_A6NJB7
OpenTargetsiENSG00000188368
PharmGKBiPA162400164

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IGDF Eukaryota
ENOG4111583 LUCA
GeneTreeiENSGT00390000010703
HOGENOMiHOG000060275
InParanoidiA6NJB7
OMAiWGPPTAF
OrthoDBi1194731at2759
PhylomeDBiA6NJB7
TreeFamiTF341908

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
284338

Protein Ontology

More...
PROi
PR:A6NJB7

Gene expression databases

BgeeiENSG00000188368 Expressed in 98 organ(s), highest expression level in right testis
ExpressionAtlasiA6NJB7 baseline and differential
GenevisibleiA6NJB7 HS

Family and domain databases

InterProiView protein in InterPro
IPR029355 Pro-rich_19
PANTHERiPTHR37346 PTHR37346, 1 hit
PfamiView protein in Pfam
PF15455 Pro-rich_19, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPRR19_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A6NJB7
Secondary accession number(s): A8K663, B3KW48, Q6P584
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 29, 2008
Last sequence update: July 24, 2007
Last modified: May 8, 2019
This is version 85 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again