Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 118 (10 Feb 2021)
Sequence version 2 (15 Jan 2008)
Previous versions | rss
Add a publicationFeedback
Protein

TRPM8 channel-associated factor 2

Gene

TCAF2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Negatively regulates the plasma membrane cation channel TRPM8 activity. Involved in the recruitment of TRPM8 to the cell surface. Promotes prostate cancer cell migration stimulation in a TRPM8-dependent manner.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processTransport

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
A6NFQ2

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
TRPM8 channel-associated factor 21 Publication
Alternative name(s):
TRP channel-associated factor 21 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TCAF2Imported
Synonyms:FAM115CImported, FAM139AImported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:26878, TCAF2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
616252, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_A6NFQ2

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000170379.19

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000170379

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162385772

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
A6NFQ2, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TCAF2

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003201871 – 919TRPM8 channel-associated factor 2Add BLAST919

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
A6NFQ2

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
A6NFQ2

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
A6NFQ2

MaxQB - The MaxQuant DataBase

More...
MaxQBi
A6NFQ2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
A6NFQ2

PeptideAtlas

More...
PeptideAtlasi
A6NFQ2

PRoteomics IDEntifications database

More...
PRIDEi
A6NFQ2

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
1064 [A6NFQ2-1]
1065 [A6NFQ2-2]
1066 [A6NFQ2-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
A6NFQ2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
A6NFQ2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 2 is expressed in the prostate and in cancerous prostate samples.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000170379, Expressed in islet of Langerhans and 111 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
A6NFQ2, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
A6NFQ2, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000170379, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Isoform 2 interacts with TRPM8 (via N-terminus and C-terminus domains); the interaction inhibits TRPM8 channel activity.

Interacts with TRPV6.

1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
130260, 26 interactors

Protein interaction database and analysis system

More...
IntActi
A6NFQ2, 20 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000412724

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
A6NFQ2, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
A6NFQ2

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini542 – 841Peptidase M60PROSITE-ProRule annotationAdd BLAST300

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TCAF family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502QQUS, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000017365

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_011215_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
A6NFQ2

Identification of Orthologs from Complete Genome Data

More...
OMAi
AHEGMLC

Database of Orthologous Groups

More...
OrthoDBi
1049811at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
A6NFQ2

TreeFam database of animal gene trees

More...
TreeFami
TF331520

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.390.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR029062, Class_I_gatase-like
IPR035423, M60-like_N
IPR042279, Pep_M60_3
IPR031161, Peptidase_M60_dom

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF17291, M60-like_N, 1 hit
PF13402, Peptidase_M60, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01276, M60-like, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52317, SSF52317, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51723, PEPTIDASE_M60, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: A6NFQ2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MATIAAAAFE ALMDGVTCWD VPRGPIPSEL LLIGEAAFPV MVNDKGQVLI
60 70 80 90 100
AASSYGRGRL VVVSHEGYLS HTGLAPFLLN AVSWLCPCPG APVGVHPSLA
110 120 130 140 150
PLVNILQDAG LEAQVKPEPG EPLGVYCINA YNDTLTATLI QFVKHGGGLL
160 170 180 190 200
IGGQAWYWAS QHGPDKVLSR FPGNKVTSVA GVYFTDTYGD RDRFKVSKKV
210 220 230 240 250
PKIPLHVRYG EDVRQDQQQL LEGISELDIR TGGVPSQLLV HGALAFPLGL
260 270 280 290 300
DASLNCFLAA AHYGRGRVVL AAHECLLCAP KMGPFLLNAV RWLARGQTGK
310 320 330 340 350
VGVNTNLKDL CPLLSEHGLQ CSLEPHLNSD LCVYCCKAYS DKEAKQLQEF
360 370 380 390 400
VAEGGGLLIG GQAWWWASQN PGHCPLAGFP GNIILNCFGL SILPQTLKAG
410 420 430 440 450
CFPVPTPEMR SYHFRKALSQ FQAILNHENG NLEKSCLAKL RVDGAAFLQI
460 470 480 490 500
PAEGVPAYIS LHRLLRKMLR GSGLPAVSRE NPVASDSYEA AVLSLATGLA
510 520 530 540 550
HSGTDCSQLA QGLGTWTCSS SLYPSKHPIT VEINGINPGN NDCWVSTGLY
560 570 580 590 600
LLEGQNAEVS LSEAAASAGL RVQIGCHTDD LTKARKLSRA PVVTHQCWMD
610 620 630 640 650
RTERSVSCLW GGLLYVIVPK GSQLGPVPVT IRGAVPAPYY KLGKTSLEEW
660 670 680 690 700
KRQMQENLAP WGELATDNII LTVPTTNLQA LKDPEPVLRL WDEMMQAVAR
710 720 730 740 750
LAAEPFPFRR PERIVADVQI SAGWMHSGYP IMCHLESVKE IINEMDMRSR
760 770 780 790 800
GVWGPIHELG HNQQRHGWEF PPHTTEATCN LWSVYVHETV LGIPRAQAHE
810 820 830 840 850
ALSPPERERR IKAHLGKGAP LCDWNVWTAL ETYLQLQEAF GWEPFTQLFA
860 870 880 890 900
EYQTLSHLPK DNTGRMNLWV KKFSEKVKKN LVPFFEAWGW PIQKEVADSL
910
ASLPEWQENP MQVYLRARK
Length:919
Mass (Da):100,906
Last modified:January 15, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC39AFA211CD43BF8
GO
Isoform 2 (identifier: A6NFQ2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     836-919: LQEAFGWEPF...PMQVYLRARK → VLSRNSGRRG

Show »
Length:845
Mass (Da):92,008
Checksum:i1EF22B5AB1256111
GO
Isoform 3 (identifier: A6NFQ2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-207: MATIAAAAFE...KKVPKIPLHV → MKIFQKEFKF...HQLQSHASGP
     538-538: P → PESHSVIQVGMQWRDLSSCNLHLLGLSNSSLSASCVAGTTGTRHHAWLIFVFLVEREFHRK

Show »
Length:815
Mass (Da):90,623
Checksum:iD1C307727E72302C
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q8N1I1Q8N1I1_HUMAN
TRPM8 channel-associated factor 2
TCAF2
564Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC03376 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti72T → A in AAN87343 (Ref. 1) Curated1
Sequence conflicti72T → A in AAI17234 (PubMed:15489334).Curated1
Sequence conflicti592V → M in AAI17234 (PubMed:15489334).Curated1
Sequence conflicti592V → M in BAC03376 (PubMed:12693554).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0420501 – 207MATIA…IPLHV → MKIFQKEFKFILKKCTPIQK YREENGNSSSSPHHQLQSHA SGP in isoform 3. 1 PublicationAdd BLAST207
Alternative sequenceiVSP_042051538P → PESHSVIQVGMQWRDLSSCN LHLLGLSNSSLSASCVAGTT GTRHHAWLIFVFLVEREFHR K in isoform 3. 1 Publication1
Alternative sequenceiVSP_031635836 – 919LQEAF…LRARK → VLSRNSGRRG in isoform 2. 2 PublicationsAdd BLAST84

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY167570 mRNA Translation: AAN87343.1
AK296318 mRNA Translation: BAG59014.1
AC073264 Genomic DNA No translation available.
AC106862 Genomic DNA No translation available.
CH236959 Genomic DNA Translation: EAL23793.1
BC113530 mRNA Translation: AAI13531.1
BC117233 mRNA Translation: AAI17234.1
AK090395 mRNA Translation: BAC03376.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS34769.1 [A6NFQ2-2]
CCDS47735.2 [A6NFQ2-3]
CCDS87559.1 [A6NFQ2-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001123497.1, NM_001130025.1
NP_001123498.2, NM_001130026.2 [A6NFQ2-3]
NP_775949.2, NM_173678.2 [A6NFQ2-2]
XP_006715990.1, XM_006715927.3
XP_006715991.1, XM_006715928.3 [A6NFQ2-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000357344; ENSP00000349902; ENSG00000170379 [A6NFQ2-2]
ENST00000411935; ENSP00000389100; ENSG00000170379 [A6NFQ2-3]
ENST00000425618; ENSP00000441099; ENSG00000170379 [A6NFQ2-3]
ENST00000441159; ENSP00000404265; ENSG00000170379 [A6NFQ2-1]
ENST00000444908; ENSP00000412724; ENSG00000170379 [A6NFQ2-2]
ENST00000643242; ENSP00000495809; ENSG00000170379 [A6NFQ2-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
285966

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:285966

UCSC genome browser

More...
UCSCi
uc003wdf.4, human [A6NFQ2-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY167570 mRNA Translation: AAN87343.1
AK296318 mRNA Translation: BAG59014.1
AC073264 Genomic DNA No translation available.
AC106862 Genomic DNA No translation available.
CH236959 Genomic DNA Translation: EAL23793.1
BC113530 mRNA Translation: AAI13531.1
BC117233 mRNA Translation: AAI17234.1
AK090395 mRNA Translation: BAC03376.1 Different initiation.
CCDSiCCDS34769.1 [A6NFQ2-2]
CCDS47735.2 [A6NFQ2-3]
CCDS87559.1 [A6NFQ2-1]
RefSeqiNP_001123497.1, NM_001130025.1
NP_001123498.2, NM_001130026.2 [A6NFQ2-3]
NP_775949.2, NM_173678.2 [A6NFQ2-2]
XP_006715990.1, XM_006715927.3
XP_006715991.1, XM_006715928.3 [A6NFQ2-2]

3D structure databases

SMRiA6NFQ2
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi130260, 26 interactors
IntActiA6NFQ2, 20 interactors
STRINGi9606.ENSP00000412724

PTM databases

iPTMnetiA6NFQ2
PhosphoSitePlusiA6NFQ2

Genetic variation databases

BioMutaiTCAF2

Proteomic databases

EPDiA6NFQ2
jPOSTiA6NFQ2
MassIVEiA6NFQ2
MaxQBiA6NFQ2
PaxDbiA6NFQ2
PeptideAtlasiA6NFQ2
PRIDEiA6NFQ2
ProteomicsDBi1064 [A6NFQ2-1]
1065 [A6NFQ2-2]
1066 [A6NFQ2-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
51007, 38 antibodies

The DNASU plasmid repository

More...
DNASUi
285966

Genome annotation databases

EnsembliENST00000357344; ENSP00000349902; ENSG00000170379 [A6NFQ2-2]
ENST00000411935; ENSP00000389100; ENSG00000170379 [A6NFQ2-3]
ENST00000425618; ENSP00000441099; ENSG00000170379 [A6NFQ2-3]
ENST00000441159; ENSP00000404265; ENSG00000170379 [A6NFQ2-1]
ENST00000444908; ENSP00000412724; ENSG00000170379 [A6NFQ2-2]
ENST00000643242; ENSP00000495809; ENSG00000170379 [A6NFQ2-2]
GeneIDi285966
KEGGihsa:285966
UCSCiuc003wdf.4, human [A6NFQ2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
285966

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TCAF2
HGNCiHGNC:26878, TCAF2
HPAiENSG00000170379, Low tissue specificity
MIMi616252, gene
neXtProtiNX_A6NFQ2
OpenTargetsiENSG00000170379
PharmGKBiPA162385772
VEuPathDBiHostDB:ENSG00000170379.19

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG502QQUS, Eukaryota
GeneTreeiENSGT00390000017365
HOGENOMiCLU_011215_0_0_1
InParanoidiA6NFQ2
OMAiAHEGMLC
OrthoDBi1049811at2759
PhylomeDBiA6NFQ2
TreeFamiTF331520

Enzyme and pathway databases

PathwayCommonsiA6NFQ2

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
285966, 2 hits in 849 CRISPR screens

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
285966
PharosiA6NFQ2, Tbio

Protein Ontology

More...
PROi
PR:A6NFQ2
RNActiA6NFQ2, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000170379, Expressed in islet of Langerhans and 111 other tissues
ExpressionAtlasiA6NFQ2, baseline and differential
GenevisibleiA6NFQ2, HS

Family and domain databases

Gene3Di1.10.390.30, 1 hit
InterProiView protein in InterPro
IPR029062, Class_I_gatase-like
IPR035423, M60-like_N
IPR042279, Pep_M60_3
IPR031161, Peptidase_M60_dom
PfamiView protein in Pfam
PF17291, M60-like_N, 1 hit
PF13402, Peptidase_M60, 1 hit
SMARTiView protein in SMART
SM01276, M60-like, 1 hit
SUPFAMiSSF52317, SSF52317, 1 hit
PROSITEiView protein in PROSITE
PS51723, PEPTIDASE_M60, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTCAF2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A6NFQ2
Secondary accession number(s): B4DK02
, Q14D25, Q17RQ4, Q8IWQ0, Q8NF84
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: January 15, 2008
Last modified: February 10, 2021
This is version 118 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again