Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 87 (08 May 2019)
Sequence version 3 (20 Jun 2018)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Protein ANKUB1

Gene

ANKUB1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein ANKUB1
Alternative name(s):
Ankyrin repeat and ubiquitin domain-containing 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ANKUB1
Synonyms:C3orf16
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:29642 ANKUB1

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_A6NFN9

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000206199

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134863258

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ANKUB1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003444631 – 502Protein ANKUB1Add BLAST502

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
A6NFN9

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
A6NFN9

PRoteomics IDEntifications database

More...
PRIDEi
A6NFN9

ProteomicsDB human proteome resource

More...
ProteomicsDBi
1063

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
A6NFN9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
A6NFN9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000206199 Expressed in 76 organ(s), highest expression level in right uterine tube

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
A6NFN9 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
A6NFN9 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA053749

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
133009, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000387907

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IFTD Eukaryota
ENOG4111I3R LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000007965

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000070231

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
A6NFN9

Identification of Orthologs from Complete Genome Data

More...
OMAi
SFYYATP

Database of Orthologous Groups

More...
OrthoDBi
974089at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
A6NFN9

TreeFam database of animal gene trees

More...
TreeFami
TF343343

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00204 ANK, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.40.20, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR029071 Ubiquitin-like_domsf
IPR000626 Ubiquitin_dom

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00240 ubiquitin, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00248 ANK, 3 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48403 SSF48403, 1 hit
SSF54236 SSF54236, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 2 (identifier: A6NFN9-2) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRIFIAFEGS FEPFDVSADE TVEVVKLMIK DYFHIPLSED KQGRRYLELM
60 70 80 90 100
YAGAALKDSW SLADVGISFC STLKCFVKEE DKPTLYVFNA VTQDTMPVME
110 120 130 140 150
SISLLDKTVS DLRTLVTLRC GLPVSVYCLR TPRGLEMYDC NTLKDYQTDI
160 170 180 190 200
GTTLRLDVWD GWKEFLMGCL LGQKLKVQRY LSKEGPVLKY QKRVALYIAA
210 220 230 240 250
FCGYIELTEW ALKQGARPHE AVGVHPYRAW CHEALHADVS KCPIHAAAEA
260 270 280 290 300
GQLLILKAFV NYSVLCLECK NAAGQTPLTI VFKHKHKDCV LYLLSKMWST
310 320 330 340 350
VSFPKISVPM RIYIKIKQWI LRAQSHSLHK SQFCGARVFG AKVGDTVMVD
360 370 380 390 400
GFTKPKMTSK SWHKAGNSDS QSIVLKLPSL SKQTASSKPV NPLAISQPDT
410 420 430 440 450
RKQALKFHPL VNASSFSELQ KHQQQNQKKI TATARKKEKL IKNTYLPQVP
460 470 480 490 500
LPPVSRVGYS HPSFFYATPS ADFLLKSSFS SFLEHSGKTP WENAIYCLAV

AR
Length:502
Mass (Da):56,600
Last modified:June 20, 2018 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB914E6E2CC0E209B
GO
Isoform 1 (identifier: A6NFN9-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     411-424: VNASSFSELQKHQQ → KGESPKADKSSGIM
     425-502: Missing.

Note: No experimental confirmation available.
Show »
Length:424
Mass (Da):47,648
Checksum:i739DDA5560DBEBC8
GO
Isoform 3 (identifier: A6NFN9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     502-502: R → SAFKEKRWLQQLEIARVLAKKSISNLTTRGGLTACENSLETVL

Show »
Length:544
Mass (Da):61,230
Checksum:iED6B2412EC0EBBC6
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JND2C9JND2_HUMAN
Protein ANKUB1
ANKUB1
39Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti81D → H in DN831909 (Ref. 4) Curated1
Sequence conflicti173Q → L in DN831909 (Ref. 4) Curated1
Sequence conflicti177V → K in DN831909 (Ref. 4) Curated1
Sequence conflicti222 – 223VG → NK in DN831909 (Ref. 4) Curated2

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_045621217R → W. Corresponds to variant dbSNP:rs7645720Ensembl.1
Natural variantiVAR_045622306I → M. Corresponds to variant dbSNP:rs3821406Ensembl.1
Natural variantiVAR_045623386S → G. Corresponds to variant dbSNP:rs7610425Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_059614411 – 424VNASS…QKHQQ → KGESPKADKSSGIM in isoform 1. Add BLAST14
Alternative sequenceiVSP_059615425 – 502Missing in isoform 1. Add BLAST78
Alternative sequenceiVSP_059616502R → SAFKEKRWLQQLEIARVLAK KSISNLTTRGGLTACENSLE TVL in isoform 3. 1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK027233 mRNA No translation available.
AK098078 mRNA No translation available.
AK304359 mRNA Translation: BAG65200.1
AC069216 Genomic DNA No translation available.
AC117395 Genomic DNA No translation available.
CR737646 mRNA No translation available.
DN831909 mRNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS82857.1 [A6NFN9-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001138432.1, NM_001144960.2 [A6NFN9-3]
NP_001302435.1, NM_001315506.1 [A6NFN9-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000446160; ENSP00000387907; ENSG00000206199 [A6NFN9-3]
ENST00000462519; ENSP00000417635; ENSG00000206199 [A6NFN9-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
389161

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:389161

UCSC genome browser

More...
UCSCi
uc062oxx.1 human [A6NFN9-2]

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK027233 mRNA No translation available.
AK098078 mRNA No translation available.
AK304359 mRNA Translation: BAG65200.1
AC069216 Genomic DNA No translation available.
AC117395 Genomic DNA No translation available.
CR737646 mRNA No translation available.
DN831909 mRNA No translation available.
CCDSiCCDS82857.1 [A6NFN9-2]
RefSeqiNP_001138432.1, NM_001144960.2 [A6NFN9-3]
NP_001302435.1, NM_001315506.1 [A6NFN9-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi133009, 1 interactor
STRINGi9606.ENSP00000387907

PTM databases

iPTMnetiA6NFN9
PhosphoSitePlusiA6NFN9

Polymorphism and mutation databases

BioMutaiANKUB1

Proteomic databases

jPOSTiA6NFN9
PaxDbiA6NFN9
PRIDEiA6NFN9
ProteomicsDBi1063

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000446160; ENSP00000387907; ENSG00000206199 [A6NFN9-3]
ENST00000462519; ENSP00000417635; ENSG00000206199 [A6NFN9-2]
GeneIDi389161
KEGGihsa:389161
UCSCiuc062oxx.1 human [A6NFN9-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
389161

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ANKUB1
HGNCiHGNC:29642 ANKUB1
HPAiHPA053749
neXtProtiNX_A6NFN9
OpenTargetsiENSG00000206199
PharmGKBiPA134863258

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IFTD Eukaryota
ENOG4111I3R LUCA
GeneTreeiENSGT00390000007965
HOGENOMiHOG000070231
InParanoidiA6NFN9
OMAiSFYYATP
OrthoDBi974089at2759
PhylomeDBiA6NFN9
TreeFamiTF343343

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ANKUB1 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
389161

Protein Ontology

More...
PROi
PR:A6NFN9

Gene expression databases

BgeeiENSG00000206199 Expressed in 76 organ(s), highest expression level in right uterine tube
ExpressionAtlasiA6NFN9 baseline and differential
GenevisibleiA6NFN9 HS

Family and domain databases

CDDicd00204 ANK, 1 hit
Gene3Di1.25.40.20, 1 hit
InterProiView protein in InterPro
IPR002110 Ankyrin_rpt
IPR020683 Ankyrin_rpt-contain_dom
IPR036770 Ankyrin_rpt-contain_sf
IPR029071 Ubiquitin-like_domsf
IPR000626 Ubiquitin_dom
PfamiView protein in Pfam
PF00240 ubiquitin, 1 hit
SMARTiView protein in SMART
SM00248 ANK, 3 hits
SUPFAMiSSF48403 SSF48403, 1 hit
SSF54236 SSF54236, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiANKUB_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A6NFN9
Secondary accession number(s): B4E2N8, E9PHT4
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 22, 2008
Last sequence update: June 20, 2018
Last modified: May 8, 2019
This is version 87 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again