Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - A6NDY0 (EPAB2_HUMAN)

Entry version 101 (18 Sep 2019)
Sequence version 1 (24 Jul 2007)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Embryonic polyadenylate-binding protein 2

Gene

PABPN1L

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Binds the poly(A) tail of mRNA.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionRNA-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Embryonic polyadenylate-binding protein 2
Short name:
Embryonic poly(A)-binding protein 2
Short name:
ePABP-2
Short name:
ePABP2
Alternative name(s):
Embryonic poly(A)-binding protein type II
Poly(A)-binding protein nuclear-like 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PABPN1L
Synonyms:EPABP2, PABPNL1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:37237 PABPN1L

neXtProt; the human protein knowledge platform

More...neXtProti		NX_A6NDY0

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		390748

Open Targets

More...OpenTargetsi		ENSG00000205022

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		A6NDY0

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		PABPN1L

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003491721 – 278Embryonic polyadenylate-binding protein 2Add BLAST278

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		A6NDY0

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		A6NDY0

MaxQB - The MaxQuant DataBase

More...MaxQBi		A6NDY0

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		A6NDY0

PRoteomics IDEntifications database

More...PRIDEi		A6NDY0

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		940 [A6NDY0-1]
941 [A6NDY0-2]
942 [A6NDY0-3]
943 [A6NDY0-4]

Consortium for Top Down Proteomics

More...TopDownProteomicsi		A6NDY0-3 [A6NDY0-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		A6NDY0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		A6NDY0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in various adult tissues.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000205022 Expressed in 49 organ(s), highest expression level in right adrenal gland

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		A6NDY0 baseline and differential

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA043415

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000408598

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini147 – 224RRMPROSITE-ProRule annotationAdd BLAST78

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG4209 Eukaryota
ENOG4111PFV LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000161325

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000208465

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		A6NDY0

KEGG Orthology (KO)

More...KOi		K14396

Identification of Orthologs from Complete Genome Data

More...OMAi		MWPFLSH

Database of Orthologous Groups

More...OrthoDBi		1412946at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		A6NDY0

TreeFam database of animal gene trees

More...TreeFami		TF105907

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.30.70.330, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR035979 RBD_domain_sf
IPR000504 RRM_dom

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00076 RRM_1, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00360 RRM, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF54928 SSF54928, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50102 RRM, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: A6NDY0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MWPFPSRSLF PPPTQAWLQT VSSDPEAQGW GAWNETKEIL GPEGGEGKEE 
        60         70         80         90        100
KEEEEDAEED QDGDAGFLLS LLEQENLAEC PLPDQELEAI KMKVCAMEQA 
       110        120        130        140        150
EGTPRPPGVQ QQAEEEEGTA AGQLLSPETV GCPLSGTPEE KVEADHRSVY 
       160        170        180        190        200
VGNVDYGGSA EELEAHFSRC GEVHRVTILC DKFSGHPKGY AYIEFATKGS 
       210        220        230        240        250
VQAAVELDQS LFRGRVIKVL PKRTNFPGIS STDRGGLRGH PGSRGAPFPH 
       260        270 
SGLQGRPRLR PQGQNRARGK FSPWFSPY
Length:278
Mass (Da):30,386
Last modified:July 24, 2007 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4662DAB7022CACD5
GO
Isoform 2 (identifier: A6NDY0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     190-190: Y → CCRKEPTSLGSAPQTAGAFEDTQAPGGHPSPTAASRAGPGSDHKGRTGPVENSHHGFHRIKGKTRF
     191-278: Missing.

Note: No experimental confirmation available.
Show »
Length:255
Mass (Da):27,382
Checksum:iCFB6377FA13689F8
GO
Isoform 4 (identifier: A6NDY0-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     267-278: ARGKFSPWFSPY → TPAALTPLWARPLPWVVVSHVIK

Note: No experimental confirmation available.
Show »
Length:289
Mass (Da):31,495
Checksum:iB7B2FE2E6A478128
GO
Isoform 3 (identifier: A6NDY0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     154-154: V → LCLHRVCHQG...RSKPLVLHPG
     155-278: Missing.

Note: No experimental confirmation available.
Show »
Length:267
Mass (Da):29,017
Checksum:i481820E362076EB9
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1C7CYY8A0A1C7CYY8_HUMAN
Embryonic polyadenylate-binding pro...
PABPN1L
266Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_035211154V → LCLHRVCHQGLRAGRRGAGP EPLPGPGHQGAAEKNQLPWD QLHRPRGPSRTPRLQGGTLP PQRPPGQAPAQTTRAEPGPW KILTMVFTVLKGRPDFERGA GAWIRSKPLVLHPG in isoform 3. 1 Publication1
Alternative sequenceiVSP_035212155 – 278Missing in isoform 3. 1 PublicationAdd BLAST124
Alternative sequenceiVSP_035213190Y → CCRKEPTSLGSAPQTAGAFE DTQAPGGHPSPTAASRAGPG SDHKGRTGPVENSHHGFHRI KGKTRF in isoform 2. 1 Publication1
Alternative sequenceiVSP_035214191 – 278Missing in isoform 2. 1 PublicationAdd BLAST88
Alternative sequenceiVSP_040501267 – 278ARGKF…WFSPY → TPAALTPLWARPLPWVVVSH VIK in isoform 4. CuratedAdd BLAST12

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AC092384 Genomic DNA No translation available.
BC130001 mRNA Translation: AAI30002.1
BC130002 mRNA Translation: AAI30003.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS45547.2 [A6NDY0-1]
CCDS73925.1 [A6NDY0-2]

NCBI Reference Sequences

More...RefSeqi		NP_001073956.2, NM_001080487.2 [A6NDY0-1]
NP_001281257.1, NM_001294328.1 [A6NDY0-2]
XP_016878719.1, XM_017023230.1 [A6NDY0-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000411789; ENSP00000405259; ENSG00000205022 [A6NDY0-2]
ENST00000419291; ENSP00000408598; ENSG00000205022 [A6NDY0-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		390748

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:390748

UCSC genome browser

More...UCSCi		uc002fmi.4 human [A6NDY0-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC092384 Genomic DNA No translation available.
BC130001 mRNA Translation: AAI30002.1
BC130002 mRNA Translation: AAI30003.1
CCDSiCCDS45547.2 [A6NDY0-1]
CCDS73925.1 [A6NDY0-2]
RefSeqiNP_001073956.2, NM_001080487.2 [A6NDY0-1]
NP_001281257.1, NM_001294328.1 [A6NDY0-2]
XP_016878719.1, XM_017023230.1 [A6NDY0-1]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

STRINGi9606.ENSP00000408598

PTM databases

iPTMnetiA6NDY0
PhosphoSitePlusiA6NDY0

Polymorphism and mutation databases

BioMutaiPABPN1L

Proteomic databases

jPOSTiA6NDY0
MassIVEiA6NDY0
MaxQBiA6NDY0
PaxDbiA6NDY0
PRIDEiA6NDY0
ProteomicsDBi940 [A6NDY0-1]
941 [A6NDY0-2]
942 [A6NDY0-3]
943 [A6NDY0-4]
TopDownProteomicsiA6NDY0-3 [A6NDY0-3]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		390748

Genome annotation databases

EnsembliENST00000411789; ENSP00000405259; ENSG00000205022 [A6NDY0-2]
ENST00000419291; ENSP00000408598; ENSG00000205022 [A6NDY0-1]
GeneIDi390748
KEGGihsa:390748
UCSCiuc002fmi.4 human [A6NDY0-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		390748
DisGeNETi390748

GeneCards: human genes, protein and diseases

More...GeneCardsi		PABPN1L
HGNCiHGNC:37237 PABPN1L
HPAiHPA043415
neXtProtiNX_A6NDY0
OpenTargetsiENSG00000205022

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG4209 Eukaryota
ENOG4111PFV LUCA
GeneTreeiENSGT00940000161325
HOGENOMiHOG000208465
InParanoidiA6NDY0
KOiK14396
OMAiMWPFLSH
OrthoDBi1412946at2759
PhylomeDBiA6NDY0
TreeFamiTF105907

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		390748
PharosiA6NDY0

Protein Ontology

More...PROi		PR:A6NDY0

Gene expression databases

BgeeiENSG00000205022 Expressed in 49 organ(s), highest expression level in right adrenal gland
ExpressionAtlasiA6NDY0 baseline and differential

Family and domain databases

Gene3Di3.30.70.330, 1 hit
InterProiView protein in InterPro
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR035979 RBD_domain_sf
IPR000504 RRM_dom
PfamiView protein in Pfam
PF00076 RRM_1, 1 hit
SMARTiView protein in SMART
SM00360 RRM, 1 hit
SUPFAMiSSF54928 SSF54928, 1 hit
PROSITEiView protein in PROSITE
PS50102 RRM, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiEPAB2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A6NDY0
Secondary accession number(s): A1L3B3, A2VDI2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 2, 2008
Last sequence update: July 24, 2007
Last modified: September 18, 2019
This is version 101 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again