Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 99 (16 Jan 2019)
Sequence version 2 (11 Sep 2007)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Putative L-aspartate dehydrogenase

Gene

ASPDH

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Specifically catalyzes the NAD or NADP-dependent dehydrogenation of L-aspartate to iminoaspartate.By similarity

Miscellaneous

The iminoaspartate product is unstable in aqueous solution and can decompose to oxaloacetate and ammonia.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: NAD(+) biosynthesis

This protein is involved in step 1 of the subpathway that synthesizes iminoaspartate from L-aspartate (dehydrogenase route).
Proteins known to be involved in this subpathway in this organism are:
  1. Putative L-aspartate dehydrogenase (ASPDH)
This subpathway is part of the pathway NAD(+) biosynthesis, which is itself part of Cofactor biosynthesis.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes iminoaspartate from L-aspartate (dehydrogenase route), the pathway NAD(+) biosynthesis and in Cofactor biosynthesis.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei127NAD; via amide nitrogenBy similarity1
Binding sitei192NADBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionOxidoreductase
Biological processPyridine nucleotide biosynthesis
LigandNAD, NADP

Enzyme and pathway databases

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00253;UER00456

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Putative L-aspartate dehydrogenase (EC:1.4.1.21)
Alternative name(s):
Aspartate dehydrogenase domain-containing protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ASPDH
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000204653.9

Human Gene Nomenclature Database

More...
HGNCi
HGNC:33856 ASPDH

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_A6ND91

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000204653

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA164716234

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ASPDH

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003006231 – 283Putative L-aspartate dehydrogenaseAdd BLAST283

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei20PhosphoserineCombined sources1
Modified residuei168PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
A6ND91

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
A6ND91

PRoteomics IDEntifications database

More...
PRIDEi
A6ND91

ProteomicsDB human proteome resource

More...
ProteomicsDBi
891
892 [A6ND91-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
A6ND91

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
A6ND91

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000204653 Expressed in 145 organ(s), highest expression level in right lobe of liver

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
A6ND91 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
A6ND91 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA042631
HPA042654

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
299841, 9 interactors

Protein interaction database and analysis system

More...
IntActi
A6ND91, 1 interactor

Molecular INTeraction database

More...
MINTi
A6ND91

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000373860

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
A6ND91

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the L-aspartate dehydrogenase family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IKT3 Eukaryota
ENOG410Y5EZ LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000004452

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000007399

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG062283

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
A6ND91

KEGG Orthology (KO)

More...
KOi
K06989

Identification of Orthologs from Complete Genome Data

More...
OMAi
SCFRLTG

Database of Orthologous Groups

More...
OrthoDBi
1182611at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
A6ND91

TreeFam database of animal gene trees

More...
TreeFami
TF315092

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR005106 Asp/hSer_DH_NAD-bd
IPR002811 Asp_DH
IPR011182 L-Asp_DH
IPR036291 NAD(P)-bd_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01958 DUF108, 1 hit
PF03447 NAD_binding_3, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF005227 Asp_dh_NAD_syn, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF51735 SSF51735, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: A6ND91-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MADRGPWRVG VVGYGRLGQS LVSRLLAQGP ELGLELVFVW NRDPGRMAGS
60 70 80 90 100
VPPSLQLQNL AALGERRPDL VVEVAHPKII HESGAQILRH ANLLVGSPSA
110 120 130 140 150
LSDQTTERQL LEASQHWDHA VFVARGALWG AEDIRRLDAA GGLRSLRVTM
160 170 180 190 200
ATHPDGFRLE GPLAAAHSPG PCTVLYEGPV RGLCPFAPRN SNTMAAAALA
210 220 230 240 250
APSLGFDGVI GVLVADTSLT DMHVVDVELS GPRGPTGRSF AVHTRRENPA
260 270 280
EPGAVTGSAT VTAFWQSLLA CCQLPSRPGI HLC
Length:283
Mass (Da):29,946
Last modified:September 11, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iFF4254EF3F14D840
GO
Isoform 2 (identifier: A6ND91-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2-65: ADRGPWRVGVVGYGRLGQSLVSRLLAQGPELGLELVFVWNRDPGRMAGSVPPSLQLQNLAALGE → GDRVKGSKS
     95-144: Missing.

Show »
Length:178
Mass (Da):18,655
Checksum:i132E8AE73F175366
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
M0QZ80M0QZ80_HUMAN
Putative L-aspartate dehydrogenase
ASPDH
134Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0QYD4M0QYD4_HUMAN
Putative L-aspartate dehydrogenase
ASPDH
51Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_062676266Q → R2 PublicationsCorresponds to variant dbSNP:rs12977172Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0387422 – 65ADRGP…AALGE → GDRVKGSKS in isoform 2. 1 PublicationAdd BLAST64
Alternative sequenceiVSP_03874395 – 144Missing in isoform 2. 1 PublicationAdd BLAST50

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
CH471135 Genomic DNA Translation: EAW71880.1
AC008743 Genomic DNA No translation available.
BC066359 mRNA Translation: AAH66359.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS33082.1 [A6ND91-2]
CCDS46153.1 [A6ND91-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001019827.2, NM_001024656.2 [A6ND91-2]
NP_001108070.1, NM_001114598.1 [A6ND91-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.436338

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000376916; ENSP00000366114; ENSG00000204653 [A6ND91-2]
ENST00000389208; ENSP00000373860; ENSG00000204653 [A6ND91-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
554235

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:554235

UCSC genome browser

More...
UCSCi
uc002psr.4 human [A6ND91-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
CH471135 Genomic DNA Translation: EAW71880.1
AC008743 Genomic DNA No translation available.
BC066359 mRNA Translation: AAH66359.1
CCDSiCCDS33082.1 [A6ND91-2]
CCDS46153.1 [A6ND91-1]
RefSeqiNP_001019827.2, NM_001024656.2 [A6ND91-2]
NP_001108070.1, NM_001114598.1 [A6ND91-1]
UniGeneiHs.436338

3D structure databases

ProteinModelPortaliA6ND91
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi299841, 9 interactors
IntActiA6ND91, 1 interactor
MINTiA6ND91
STRINGi9606.ENSP00000373860

PTM databases

iPTMnetiA6ND91
PhosphoSitePlusiA6ND91

Polymorphism and mutation databases

BioMutaiASPDH

Proteomic databases

jPOSTiA6ND91
PaxDbiA6ND91
PRIDEiA6ND91
ProteomicsDBi891
892 [A6ND91-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
554235
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000376916; ENSP00000366114; ENSG00000204653 [A6ND91-2]
ENST00000389208; ENSP00000373860; ENSG00000204653 [A6ND91-1]
GeneIDi554235
KEGGihsa:554235
UCSCiuc002psr.4 human [A6ND91-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
554235
EuPathDBiHostDB:ENSG00000204653.9

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ASPDH
HGNCiHGNC:33856 ASPDH
HPAiHPA042631
HPA042654
neXtProtiNX_A6ND91
OpenTargetsiENSG00000204653
PharmGKBiPA164716234

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IKT3 Eukaryota
ENOG410Y5EZ LUCA
GeneTreeiENSGT00390000004452
HOGENOMiHOG000007399
HOVERGENiHBG062283
InParanoidiA6ND91
KOiK06989
OMAiSCFRLTG
OrthoDBi1182611at2759
PhylomeDBiA6ND91
TreeFamiTF315092

Enzyme and pathway databases

UniPathwayi
UPA00253;UER00456

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ASPDH human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
554235

Protein Ontology

More...
PROi
PR:A6ND91

Gene expression databases

BgeeiENSG00000204653 Expressed in 145 organ(s), highest expression level in right lobe of liver
ExpressionAtlasiA6ND91 baseline and differential
GenevisibleiA6ND91 HS

Family and domain databases

InterProiView protein in InterPro
IPR005106 Asp/hSer_DH_NAD-bd
IPR002811 Asp_DH
IPR011182 L-Asp_DH
IPR036291 NAD(P)-bd_dom_sf
PfamiView protein in Pfam
PF01958 DUF108, 1 hit
PF03447 NAD_binding_3, 1 hit
PIRSFiPIRSF005227 Asp_dh_NAD_syn, 1 hit
SUPFAMiSSF51735 SSF51735, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiASPD_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A6ND91
Secondary accession number(s): Q6NZ37
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: September 11, 2007
Last modified: January 16, 2019
This is version 99 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again