Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 96 (08 May 2019)
Sequence version 2 (15 Jan 2008)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Protein FAM83G

Gene

FAM83G

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May regulate the bone morphogenetic proteins (BMP) pathway.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

  • BMP signaling pathway Source: UniProtKB

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein FAM83G
Alternative name(s):
Protein associated with SMAD11 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FAM83G
Synonyms:PAWS11 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:32554 FAM83G

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
615886 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_A6ND36

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi610S → A: Completely abolishes phosphorylation by ALK3 in vitro. NEDD9 and ASNS activation in response to BMPs is abolished. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
644815

Open Targets

More...
OpenTargetsi
ENSG00000188522

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA144596433

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
FAM83G

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003308172 – 823Protein FAM83GAdd BLAST822

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineCombined sources1
Modified residuei4PhosphoserineCombined sources1
Modified residuei124PhosphoserineCombined sources1
Modified residuei127PhosphoserineCombined sources1
Modified residuei356PhosphoserineCombined sources1
Modified residuei610Phosphoserine1 Publication1
Modified residuei614Phosphoserine1 Publication1
Modified residuei616Phosphoserine1 Publication1
Modified residuei650PhosphoserineCombined sources1
Modified residuei666PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

BMP signaling induces the phosphorylation of PAWS1 by BMPR1A at Ser-610, Ser-614 and Ser-616. In response to BMP phosphorylation at Ser-610 is necessary for the activation of SMAD4-independent BMP target genes such as NEDD9 and ASNS.1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
A6ND36

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
A6ND36

MaxQB - The MaxQuant DataBase

More...
MaxQBi
A6ND36

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
A6ND36

PRoteomics IDEntifications database

More...
PRIDEi
A6ND36

ProteomicsDB human proteome resource

More...
ProteomicsDBi
879
880 [A6ND36-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
A6ND36

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
A6ND36

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000188522 Expressed in 143 organ(s), highest expression level in amniotic fluid

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
A6ND36 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
A6ND36 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA023369
HPA023940

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Found in a macromolecular complex with SMAD1. Interacts with SMAD1 (via MH2 domain); in a SMAD4-independent manner.1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
569917, 11 interactors

Protein interaction database and analysis system

More...
IntActi
A6ND36, 4 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000373647

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
A6ND36

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi470 – 511Pro-richAdd BLAST42
Compositional biasi583 – 586Poly-Asp4

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the FAM83 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IJIT Eukaryota
ENOG410YAC2 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157932

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000112487

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
A6ND36

Identification of Orthologs from Complete Genome Data

More...
OMAi
VEMFDRQ

Database of Orthologous Groups

More...
OrthoDBi
354494at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
A6ND36

TreeFam database of animal gene trees

More...
TreeFami
TF330777

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR012461 FAM83_N

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07894 FAM83, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: A6ND36-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAFSQVQCLD DNHVNWRSSE SKPEFFYSEE QRLALEALVA RGRDAFYEVL
60 70 80 90 100
KRENIRDFLS ELELKRILET IEVYDPGSED PRGTGPSQGP EDNGVGDGEE
110 120 130 140 150
ASGADGVPIE AEPLPSLEYW PQKSDRSIPQ LDLGWPDTIA YRGVTRASVY
160 170 180 190 200
MQPPIDGQAH IKEVVRKMIS QAQKVIAVVM DMFTDVDIFK DLLDAGFKRK
210 220 230 240 250
VAVYIIVDES NVKYFLHMCE RACMHLGHLK NLRVRSSGGT EFFTRSATKF
260 270 280 290 300
KGALAQKFMF VDGDRAVCGS YSFTWSAART DRNVISVLSG QVVEMFDRQF
310 320 330 340 350
QELYLMSHSV SLKGIPMEKE PEPEPIVLPS VVPLVPAGTV AKKLVNPKYA
360 370 380 390 400
LVKAKSVDEI AKISSEKQEA KKPLGLKGPA LAEHPGELPE LLPPIHPGLL
410 420 430 440 450
HLERANMFEY LPTWVEPDPE PGSDILGYIN IIDPNIWNPQ PSQMNRIKIR
460 470 480 490 500
DTSQASAQHQ LWKQSQDSRP RPEPCPPPEP SAPQDGVPAE NGLPQGDPEP
510 520 530 540 550
LPPVPKPRTV PVADVLARDS SDIGWVLELP KEEAPQNGTD HRLPRMAGPG
560 570 580 590 600
HAPLQRQLSV TQDDPESLGV GLPNGLDGVE EEDDDDYVTL SDQDSHSGSS
610 620 630 640 650
GRGPGPRRPS VASSVSEEYF EVREHSVPLR RRHSEQVANG PTPPPRRQLS
660 670 680 690 700
APHITRGTFV GPQGGSPWAQ SRGREEADAL KRMQAQRSTD KEAQGQQFHH
710 720 730 740 750
HRVPASGTRD KDGFPGPPRY RSAADSVQSS TRNAGPAMAG PHHWQAKGGQ
760 770 780 790 800
VPRLLPDPGS PRLAQNARPM TDGRATEEHP SPFGIPYSKL SQSKHLKART
810 820
GGSQWASSDS KRRAQAPRDR KDP
Length:823
Mass (Da):90,835
Last modified:January 15, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iFAAF2B78CB76725F
GO
Isoform 2 (identifier: A6ND36-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-248: Missing.
     249-271: KFKGALAQKFMFVDGDRAVCGSY → MGARGLGGGSRVMCLTSAPSLCC
     695-725: GQQFHHHRVPASGTRDKDGFPGPPRYRSAAD → VGQGPCTPGVTSPSLPATQELELLSSGLPCP
     726-823: Missing.

Show »
Length:477
Mass (Da):51,540
Checksum:iF83FADF2048A8D62
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
K7EKG0K7EKG0_HUMAN
Protein FAM83G
FAM83G
142Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_07571364L → F Found in patient with Joubert syndrome; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs371100508Ensembl.1
Natural variantiVAR_053903109I → T. Corresponds to variant dbSNP:rs2074283Ensembl.1
Natural variantiVAR_075714630R → W Found in patient with Joubert syndrome; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs201046878Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0331201 – 248Missing in isoform 2. 1 PublicationAdd BLAST248
Alternative sequenceiVSP_033121249 – 271KFKGA…VCGSY → MGARGLGGGSRVMCLTSAPS LCC in isoform 2. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_033122695 – 725GQQFH…RSAAD → VGQGPCTPGVTSPSLPATQE LELLSSGLPCP in isoform 2. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_033123726 – 823Missing in isoform 2. 1 PublicationAdd BLAST98

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK123558 mRNA Translation: BAC85645.1
AC090286 Genomic DNA No translation available.
BC105988 mRNA Translation: AAI05989.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS42276.1 [A6ND36-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001035088.2, NM_001039999.2 [A6ND36-1]
XP_016880442.1, XM_017024953.1 [A6ND36-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000345041; ENSP00000343279; ENSG00000188522 [A6ND36-1]
ENST00000388995; ENSP00000373647; ENSG00000188522 [A6ND36-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
644815

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:644815

UCSC genome browser

More...
UCSCi
uc002guw.4 human [A6ND36-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK123558 mRNA Translation: BAC85645.1
AC090286 Genomic DNA No translation available.
BC105988 mRNA Translation: AAI05989.1
CCDSiCCDS42276.1 [A6ND36-1]
RefSeqiNP_001035088.2, NM_001039999.2 [A6ND36-1]
XP_016880442.1, XM_017024953.1 [A6ND36-1]

3D structure databases

SMRiA6ND36
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi569917, 11 interactors
IntActiA6ND36, 4 interactors
STRINGi9606.ENSP00000373647

PTM databases

iPTMnetiA6ND36
PhosphoSitePlusiA6ND36

Polymorphism and mutation databases

BioMutaiFAM83G

Proteomic databases

EPDiA6ND36
jPOSTiA6ND36
MaxQBiA6ND36
PaxDbiA6ND36
PRIDEiA6ND36
ProteomicsDBi879
880 [A6ND36-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000345041; ENSP00000343279; ENSG00000188522 [A6ND36-1]
ENST00000388995; ENSP00000373647; ENSG00000188522 [A6ND36-1]
GeneIDi644815
KEGGihsa:644815
UCSCiuc002guw.4 human [A6ND36-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
644815
DisGeNETi644815

GeneCards: human genes, protein and diseases

More...
GeneCardsi
FAM83G

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0027207
HGNCiHGNC:32554 FAM83G
HPAiHPA023369
HPA023940
MIMi615886 gene
neXtProtiNX_A6ND36
OpenTargetsiENSG00000188522
PharmGKBiPA144596433

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IJIT Eukaryota
ENOG410YAC2 LUCA
GeneTreeiENSGT00940000157932
HOGENOMiHOG000112487
InParanoidiA6ND36
OMAiVEMFDRQ
OrthoDBi354494at2759
PhylomeDBiA6ND36
TreeFamiTF330777

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
644815

Protein Ontology

More...
PROi
PR:A6ND36

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000188522 Expressed in 143 organ(s), highest expression level in amniotic fluid
ExpressionAtlasiA6ND36 baseline and differential
GenevisibleiA6ND36 HS

Family and domain databases

InterProiView protein in InterPro
IPR012461 FAM83_N
PfamiView protein in Pfam
PF07894 FAM83, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFA83G_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A6ND36
Secondary accession number(s): Q3KQZ4, Q6ZW60
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 29, 2008
Last sequence update: January 15, 2008
Last modified: May 8, 2019
This is version 96 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again