Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transcription factor TFIIIB component B'' homolog

Gene

BDP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

General activator of RNA polymerase III transcription. Requires for transcription from all three types of polymerase III promoters. Requires for transcription of genes with internal promoter elements and with promoter elements upstream of the initiation site.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator
Biological processTranscription, Transcription regulation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-749476 RNA Polymerase III Abortive And Retractive Initiation
R-HSA-76061 RNA Polymerase III Transcription Initiation From Type 1 Promoter
R-HSA-76066 RNA Polymerase III Transcription Initiation From Type 2 Promoter
R-HSA-76071 RNA Polymerase III Transcription Initiation From Type 3 Promoter

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
A6H8Y1

SIGNOR Signaling Network Open Resource

More...
SIGNORi
A6H8Y1

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Transcription factor TFIIIB component B'' homolog
Alternative name(s):
Transcription factor IIIB 150
Short name:
TFIIIB150
Transcription factor-like nuclear regulator
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:BDP1
Synonyms:KIAA1241, KIAA1689, TFNR
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000145734.18

Human Gene Nomenclature Database

More...
HGNCi
HGNC:13652 BDP1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
607012 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_A6H8Y1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi390S → A: Not phosphorylated by CSNK2A1; when associated with A-426; A-431; A-437 and A-446. CK2 treatment constitutively activates for U6 transcription; when associated with A-426; A-431; A-437 and A-446. 1 Publication1
Mutagenesisi426S → A: Not phosphorylated by CSNK2A1; when associated with A-390; A-431; A-437 and A-446. CK2 treatment constitutively activates for U6 transcription; when associated with A-390; A-431; A-437 and A-446. 1 Publication1
Mutagenesisi431S → A: Not phosphorylated by CSNK2A1; when associated with A-390; A-426; A-437 and A-446. CK2 treatment constitutively activates for U6 transcription; when associated with A-390; A-426; A-437 and A-446. 1 Publication1
Mutagenesisi437T → A: Not phosphorylated by CSNK2A1; when associated with A-390; A-426; A-431 and A-446. CK2 treatment constitutively activates for U6 transcription; when associated with A-390; A-426; A-431 and A-446. 1 Publication1
Mutagenesisi446S → A: Not phosphorylated by CSNK2A1; when associated with A-390; A-426; A-431 and A-437. CK2 treatment constitutively activates for U6 transcription; when associated with A-390; A-426; A-431 and A-437. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
55814

MalaCards human disease database

More...
MalaCardsi
BDP1

Open Targets

More...
OpenTargetsi
ENSG00000145734

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
90636 Autosomal recessive non-syndromic sensorineural deafness type DFNB

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA25336

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
BDP1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003338631 – 2624Transcription factor TFIIIB component B'' homologAdd BLAST2624

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei915PhosphothreonineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated by CSNK2A1 during mitosis, resulting in its release from chromatin and suppression of polymerase III transcription.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
A6H8Y1

MaxQB - The MaxQuant DataBase

More...
MaxQBi
A6H8Y1

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
A6H8Y1

PRoteomics IDEntifications database

More...
PRIDEi
A6H8Y1

ProteomicsDB human proteome resource

More...
ProteomicsDBi
777
778 [A6H8Y1-2]
779 [A6H8Y1-3]
780 [A6H8Y1-4]
781 [A6H8Y1-5]
782 [A6H8Y1-6]
783 [A6H8Y1-7]
784 [A6H8Y1-8]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
A6H8Y1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
A6H8Y1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 2 is highly expressed in cerebellum.1 Publication

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By Epstein-Barr virus (EBV) resulting in the stimulation of the EBV EBER genes.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000145734 Expressed in 210 organ(s), highest expression level in tendon

CleanEx database of gene expression profiles

More...
CleanExi
HS_BDP1

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
A6H8Y1 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
A6H8Y1 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of TFIIIB complex. The TFIIIB complex has two activities, alpha and beta. The TFIIIB-alpha and TFIIIB-beta activities are required for transcription of genes with TFIIIC-bound internal promoters and PSE transcription factor-bound external promoters, respectively. The TFIIIB-alpha activity complex is composed of TBP, BDP1, and a complex containing both BRF2 and at least four stably associated proteins; YY1 facilitates the formation of TFIIIB-alpha activity complex. The TFIIIB-beta activity complex is composed of TBP, BDP1, and BRF1. Interacts with BRF1; this interaction diminishes during mitosis resulting in the release of BDP1 from chromosomal templates. Component of TFIIIC complex. The TFIIIC complex has two activities, C1 and C2. The TFIIIC2 activity complex is only required for transcription of the 'classical' pol III genes whereas the TFIIIC1 activity complex is required for transcription of all pol III genes. The TFIIIC1 activity complex is composed at least of BDP1. Interacts with ZBTB43.3 Publications

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
120924, 43 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
A6H8Y1

Database of interacting proteins

More...
DIPi
DIP-62076N

Protein interaction database and analysis system

More...
IntActi
A6H8Y1, 17 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000351575

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

12624
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
A6H8Y1

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
A6H8Y1

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini295 – 345Myb-likeAdd BLAST51
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati823 – 8771; approximateAdd BLAST55
Repeati878 – 9322Add BLAST55
Repeati933 – 9873Add BLAST55
Repeati988 – 10404Add BLAST53
Repeati1041 – 10945Add BLAST54
Repeati1095 – 11486Add BLAST54
Repeati1149 – 12037Add BLAST55
Repeati1204 – 12578; approximateAdd BLAST54
Repeati1258 – 13279; approximateAdd BLAST70

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 299Interaction with ZBTB431 PublicationAdd BLAST299
Regioni355 – 470Required for phosphorylation by CSNK2A1Add BLAST116
Regioni823 – 13279 X 55 AA repeats of G-R-R-X-I-S-P-X-E-N-G-X-E-E-V-K-P-X-X-E-M-E-T-D-L-K-X-T-G-R-E-X-X-X-R-E-K-T-X-E-X-X-D-A-X-E-E-I-D-X-D-L-E-E-TAdd BLAST505

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili144 – 177Sequence analysisAdd BLAST34
Coiled coili1078 – 1103Sequence analysisAdd BLAST26
Coiled coili1223 – 1284Sequence analysisAdd BLAST62

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi84 – 119Ser-richAdd BLAST36

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2009 Eukaryota
COG5118 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000012762

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG107497

KEGG Orthology (KO)

More...
KOi
K15198

Identification of Orthologs from Complete Genome Data

More...
OMAi
VKPVDEM

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0GQF

Database for complete collections of gene phylogenies

More...
PhylomeDBi
A6H8Y1

TreeFam database of animal gene trees

More...
TreeFami
TF328878

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR009057 Homeobox-like_sf
IPR001005 SANT/Myb
IPR030701 TFIIIB_B''
IPR039467 TFIIIB_B''_Myb

The PANTHER Classification System

More...
PANTHERi
PTHR22929 PTHR22929, 4 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF15963 Myb_DNA-bind_7, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00717 SANT, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF46689 SSF46689, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (8+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 8 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 8 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: A6H8Y1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MFRRARLSVK PNVRPGVGAR GSTASNPQRG RESPRPPDPA TDSASKPAEP
60 70 80 90 100
TDVPTVDFGG AEPQEKAPRS STEKTGGDND VEESSRSSST VSQRRKRISS
110 120 130 140 150
TSSLVKSSVS VPSESHPLST INQEAPQPTA TSTKEKQPCS DRYRIYKAQK
160 170 180 190 200
LREMLKEELR KEKKQWKNKY AINESQRPPD RSKMTMRDFI YYLPDNNPMT
210 220 230 240 250
SSLEQEKKTE KPSTPVQTRE QEGKSTPNAE DNEMEEETDD GPLLVPRVKV
260 270 280 290 300
AEDGSIILDE ESLTVEVLRT KGPCVVEEND PIFERGSTTT YSSFRKNYYS
310 320 330 340 350
KPWSNKETDM FFLAISMVGT DFSMIGQLFP HRARIEIKNK FKREEKTNGW
360 370 380 390 400
RIDKAFQEKR PFDFDFFAHL LQKVLAEEEK RKQKSVKNHS LKEKKSTKPR
410 420 430 440 450
KNVKVKKVAC EGVNNDPDES MSSRISDTER SQKDAQTVEE ESLTLSREDA
460 470 480 490 500
EQVALEVDLN QKKRRRKKQD GANELGVNNL LENATVQAGP SKGEKHKNKC
510 520 530 540 550
QAIRPELKEG ECSKEQMLSC TQNIDGIVGF ASTEKVEKRT DPILSLSNQQ
560 570 580 590 600
DATSVATESS ESSTSDLPSF EVGIRALCEV NNAEGSCIEE RNVDLKNNSL
610 620 630 640 650
EIDQTENVKP MLRGRFQRPK PNLSRAGKKS VLSQGKTESE SKNSHSKTSV
660 670 680 690 700
EKNHVEKDKM NTLDILRMET TERENPEAET VSVLGEKNCL QEGSQLKALR
710 720 730 740 750
PVQVRGRLQK PKPNAGKAAE RKEILISQEE IGANVEKNEN ESCADRDTPQ
760 770 780 790 800
HMEDQSRKDF EEEDVILQPE KNDSFQNVQP DEPKVLNECL SVQENNKANK
810 820 830 840 850
LNQVPILRTR FQKPKPNIGR GTGRREISSK EEVLEKILVS GEMAAALRET
860 870 880 890 900
VRLDTSPKEM VPAEINTKEM QSDLKETGRR AISPREKILD VIDDTIEMET
910 920 930 940 950
GLKAMGREIC LREKTPEVID ATEEIDKDLE EAGRREISPQ KNGPEEVKPL
960 970 980 990 1000
GEVETDLKAT GNESSPREKT PEVTDATEEI DKNLEETGRR KISPRENGPE
1010 1020 1030 1040 1050
EVKPVDEMET DLNATGRESS PREKTPEVID ATEEIDLEET EREVSPQENG
1060 1070 1080 1090 1100
LEEVKPLGEM ETDLKATGRD SFPRGKTPEV IDAIEEIEID LEETEREISP
1110 1120 1130 1140 1150
QENGLEEVKP LGEMQTDLKA TGREISPREK TPEVIDATEE IDKDLEETGR
1160 1170 1180 1190 1200
REISPEENGP EEVKPVDEME TDLKTTGREG SSREKTREVI DAAEVIETDL
1210 1220 1230 1240 1250
EETEREISPQ ENGPEEVKPV GKMETDLKEI REEISQREKV LAEFSAIREK
1260 1270 1280 1290 1300
EIDLKETGKR DIPIMEKVSG KMAVVEEMEA DLKETGKENF RERGSEEICV
1310 1320 1330 1340 1350
TEEKVAELKQ TGKTDISPRE NELEETSTSR QTDTHLMQSG SNDFSAVPSL
1360 1370 1380 1390 1400
DIQNISSEVL SMMHTPVEEK RNSEKEVSSH FSHFKISSQT HESDKTEVQG
1410 1420 1430 1440 1450
IQSPDVPEQF SDINLSKSLP QEQKPLEIKP APFVRSRFKR PKPNLARAAL
1460 1470 1480 1490 1500
KRETTESEKY IYEKKSETKK METIVMQENN EQTDTLPSQH DEASLMISRE
1510 1520 1530 1540 1550
KDTLGHRNEE AVILPCTQTE RNLSPSNSCE PKEESQSAPV QKNDSVVSVG
1560 1570 1580 1590 1600
TNNVNTFQQE MKESVIQTAR QVRGRLQRPR PNIRKTGQRQ IVDKGEAKGI
1610 1620 1630 1640 1650
IKEGRTILPK DETEKKVLTV SNSQIETEIE VPSSAVPEHR MYENQSQVVL
1660 1670 1680 1690 1700
VENLHVNKTN ETIRHENKPY VPSSAQMTRR KFQKAKPNLG RAHSKKEEPV
1710 1720 1730 1740 1750
LEKVTTDQSK EGKPEDHLLQ KGASNTQLLL KEKAELLTSL EVSARKDCVG
1760 1770 1780 1790 1800
SKESALAKID AELEEVGPSR RVGEETVGDN SPSSVVEEQY LNKLTSCPQP
1810 1820 1830 1840 1850
LNETSYSKIA LDGKTTISST SEYERNRGER RSHKKFKPNV TRGRGSKRVR
1860 1870 1880 1890 1900
GKTSKKEPRA SKAMLVTLRA SQEEDDDADD FESDYEEESY HLAPEEVNKA
1910 1920 1930 1940 1950
PVFVPVGLRS PEPVSAQIEE TMEELEITVN VPDVGCIAVV EHELPNTDVT
1960 1970 1980 1990 2000
TEEMKQEENL SVPFEMTTSE HIQDEPGTND GSTEAAITLL TMGDLVLQSE
2010 2020 2030 2040 2050
ISSEQGDVGV CIIPHVHSKD KSHIPSSLDN VNHKIVHECQ ELSSPVITTS
2060 2070 2080 2090 2100
PASFEENKIV LEEQSSREEI SLMEKVKENA TPTRNTISKV TSNLRIRSRL
2110 2120 2130 2140 2150
AKPKPNLEKT LGTNRLDDYQ EVSSLCVTKG AEMETQRETE KNASKATELE
2160 2170 2180 2190 2200
NKNLGPVTTA ENKDQSKLAC VHGIKGTSIS SEVNLTERNE NQEESSQEVH
2210 2220 2230 2240 2250
MLSVAPVASS ETGPCTLGLD RGLGENSVEE PQIKDSKGDS VLTLPVPEYT
2260 2270 2280 2290 2300
PTSIPEVQQE NIINPQDLTV NLVANVPQDG EDEQAFILTL VEIPANAVEE
2310 2320 2330 2340 2350
FTDATAQFMP NPLLPAPILV KSVNTEERGD MSICLPATSV GQDAMGLSIS
2360 2370 2380 2390 2400
GRDNSKKPPD NLDLVSRKRF QCRLDKNDHI PPAKKRSLTL RDDCQEYTTE
2410 2420 2430 2440 2450
VHSKELTNVF EETGESHKGQ DIFLTSGSTL TTPEPQRQQV EAAFQSRGSR
2460 2470 2480 2490 2500
SPDACMDKNV PQLPQDEMIV SDKEERTDAA PKSQQMDSRT SSSKASLSRP
2510 2520 2530 2540 2550
GRRPLGFLSL ICSKNSLESD EPMQVHSKKR LKPLIPGLRK KLKRSNPFNE
2560 2570 2580 2590 2600
SQEKNRESSD LLPSPSVITT QSENISSSAT QVSCDQPLLK EGYKSAQKRA
2610 2620
PQGEATTVSE YFFNDIFIEV DETE
Length:2,624
Mass (Da):293,885
Last modified:January 11, 2011 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iCB7B80EBBF06B557
GO
Isoform 2 (identifier: A6H8Y1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2249-2254: YTPTSI → VKECTV
     2255-2624: Missing.

Show »
Length:2,254
Mass (Da):252,841
Checksum:i5028C313143A257A
GO
Isoform 3 (identifier: A6H8Y1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1354-1388: NISSEVLSMMHTPVEEKRNSEKEVSSHFSHFKISS → VCIFLSFKSFLNAFSEEINNSMIILSLSPTTLKNL
     1389-2624: Missing.

Show »
Length:1,388
Mass (Da):156,401
Checksum:iCA5A8B8025222C59
GO
Isoform 4 (identifier: A6H8Y1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1354-1372: NISSEVLSMMHTPVEEKRN → VCIFLSFKSFLNAFFRGNK
     1373-2624: Missing.

Show »
Length:1,372
Mass (Da):154,704
Checksum:iE9E1E54C426362F8
GO
Isoform 5 (identifier: A6H8Y1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-610: Missing.
     1354-1388: NISSEVLSMMHTPVEEKRNSEKEVSSHFSHFKISS → VCIFLSFKSFLNAFSEEINNSMIILSLSPTTFKNL
     1389-2624: Missing.

Note: No experimental confirmation available.
Show »
Length:778
Mass (Da):87,789
Checksum:iB0472F9FC6FB6897
GO
Isoform 6 (identifier: A6H8Y1-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     24-43: Missing.

Note: No experimental confirmation available.
Show »
Length:2,604
Mass (Da):291,768
Checksum:i006AAB63089EB64F
GO
Isoform 7 (identifier: A6H8Y1-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1977-2008: Missing.
     2582-2584: VSC → RPF
     2585-2624: Missing.

Note: No experimental confirmation available.
Show »
Length:2,552
Mass (Da):286,185
Checksum:iF159FF75502B6844
GO
Isoform 8 (identifier: A6H8Y1-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1863: Missing.
     2008-2008: Missing.
     2271-2327: NLVANVPQDG...ILVKSVNTEE → FVYQQLQLVK...FLLPKNVHSL
     2328-2624: Missing.

Note: No experimental confirmation available.
Show »
Length:463
Mass (Da):51,420
Checksum:i054AFA93526C7083
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MRX7A0A0A0MRX7_HUMAN
Transcription factor TFIIIB compone...
BDP1
846Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JNU3A0A0G2JNU3_HUMAN
Transcription factor TFIIIB compone...
BDP1
2,624Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JN16A0A0G2JN16_HUMAN
Transcription factor TFIIIB compone...
BDP1
846Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C5U4H7C5U4_HUMAN
Transcription factor TFIIIB compone...
BDP1
583Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YCV8H0YCV8_HUMAN
Transcription factor TFIIIB compone...
BDP1
606Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAG09268 differs from that shown. Reason: Frameshift at positions 837 and 863.Curated
The sequence AAH32146 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence BAA86555 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAB21780 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence CAH18085 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti8S → N in AAG09268 (Ref. 9) Curated1
Sequence conflicti233E → G in AAG30221 (PubMed:11040218).Curated1
Sequence conflicti233E → G in AAG30220 (PubMed:11040218).Curated1
Sequence conflicti575R → K in BAB71602 (PubMed:14702039).Curated1
Sequence conflicti683V → D in CAC21448 (PubMed:11161782).Curated1
Sequence conflicti881A → T in AAG09268 (Ref. 9) Curated1
Sequence conflicti973V → G in CAC21448 (PubMed:11161782).Curated1
Sequence conflicti973V → G in CAC04245 (PubMed:11161782).Curated1
Sequence conflicti1009E → G in AAG30221 (PubMed:11040218).Curated1
Sequence conflicti1009E → G in AAG30220 (PubMed:11040218).Curated1
Sequence conflicti2580T → A in CAE46010 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_05674326N → S. Corresponds to variant dbSNP:rs3748042Ensembl.1
Natural variantiVAR_04331238D → E4 PublicationsCorresponds to variant dbSNP:rs3748043EnsemblClinVar.1
Natural variantiVAR_056744125A → V. Corresponds to variant dbSNP:rs9687593Ensembl.1
Natural variantiVAR_056745722K → E. Corresponds to variant dbSNP:rs36009281EnsemblClinVar.1
Natural variantiVAR_043313757R → C3 PublicationsCorresponds to variant dbSNP:rs3761966EnsemblClinVar.1
Natural variantiVAR_043314778V → M. Corresponds to variant dbSNP:rs3761967EnsemblClinVar.1
Natural variantiVAR_0567461180G → S. Corresponds to variant dbSNP:rs715748EnsemblClinVar.1
Natural variantiVAR_0567471244F → I2 PublicationsCorresponds to variant dbSNP:rs1961760EnsemblClinVar.1
Natural variantiVAR_0433151264I → M3 PublicationsCorresponds to variant dbSNP:rs715747EnsemblClinVar.1
Natural variantiVAR_0433161347V → M5 PublicationsCorresponds to variant dbSNP:rs6886336EnsemblClinVar.1
Natural variantiVAR_0433171469K → E2 PublicationsCorresponds to variant dbSNP:rs1698063EnsemblClinVar.1
Natural variantiVAR_0567481676Q → E. Corresponds to variant dbSNP:rs12187098EnsemblClinVar.1
Natural variantiVAR_0433182013I → L2 PublicationsCorresponds to variant dbSNP:rs6453014EnsemblClinVar.1
Natural variantiVAR_0567492555N → S. Corresponds to variant dbSNP:rs17276250Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0335671 – 1863Missing in isoform 8. 1 PublicationAdd BLAST1863
Alternative sequenceiVSP_0335681 – 610Missing in isoform 5. 1 PublicationAdd BLAST610
Alternative sequenceiVSP_03356924 – 43Missing in isoform 6. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_0335701354 – 1388NISSE…FKISS → VCIFLSFKSFLNAFSEEINN SMIILSLSPTTLKNL in isoform 3. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_0335711354 – 1388NISSE…FKISS → VCIFLSFKSFLNAFSEEINN SMIILSLSPTTFKNL in isoform 5. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_0335721354 – 1372NISSE…EEKRN → VCIFLSFKSFLNAFFRGNK in isoform 4. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_0335731373 – 2624Missing in isoform 4. 1 PublicationAdd BLAST1252
Alternative sequenceiVSP_0335741389 – 2624Missing in isoform 3 and isoform 5. 2 PublicationsAdd BLAST1236
Alternative sequenceiVSP_0335751977 – 2008Missing in isoform 7. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_0335762008Missing in isoform 8. 1 Publication1
Alternative sequenceiVSP_0335772249 – 2254YTPTSI → VKECTV in isoform 2. 1 Publication6
Alternative sequenceiVSP_0335782255 – 2624Missing in isoform 2. 1 PublicationAdd BLAST370
Alternative sequenceiVSP_0335792271 – 2327NLVAN…VNTEE → FVYQQLQLVKMPWVYLFLEE IILKSRLIIWILYLGRDFNA GLIKMTTFLLPKNVHSL in isoform 8. 1 PublicationAdd BLAST57
Alternative sequenceiVSP_0335802328 – 2624Missing in isoform 8. 1 PublicationAdd BLAST297
Alternative sequenceiVSP_0335812582 – 2584VSC → RPF in isoform 7. 1 Publication3
Alternative sequenceiVSP_0335822585 – 2624Missing in isoform 7. 1 PublicationAdd BLAST40

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF298151 mRNA Translation: AAG30220.1
AF298152 mRNA Translation: AAG30221.1
AJ238520 mRNA Translation: CAC04245.1
AJ278892 Genomic DNA Translation: CAC17771.1
AJ279120
, AJ279121, AJ279122, AJ279123, AJ279124, AJ279125, AJ279126, AJ279127, AJ279128, AJ279129, AJ279130, AJ279131, AJ279132, AJ279133, AJ279134, AJ279135, AJ279136, AJ279137, AJ279138, AJ279139, AJ279140, AJ279141, AJ279142, AJ279143, AJ279144, AJ279145, AJ279146, AJ279147, AJ279148, AJ279149, AJ279150 Genomic DNA Translation: CAC21448.1
AB033067 mRNA Translation: BAA86555.1 Different initiation.
AB051476 mRNA Translation: BAB21780.3 Different initiation.
BX641011 mRNA Translation: CAE46010.1
CR749229 mRNA Translation: CAH18085.1 Different initiation.
CR749289 mRNA Translation: CAH18144.1
AC138832 Genomic DNA No translation available.
BC032146 mRNA Translation: AAH32146.1 Sequence problems.
BC146792 mRNA Translation: AAI46793.1
AF176695 mRNA Translation: AAG09268.1 Frameshift.
AK057871 mRNA Translation: BAB71602.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS43328.1 [A6H8Y1-1]

NCBI Reference Sequences

More...
RefSeqi
NP_060899.2, NM_018429.2 [A6H8Y1-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.258272

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000358731; ENSP00000351575; ENSG00000145734 [A6H8Y1-1]
ENST00000617085; ENSP00000482469; ENSG00000273873 [A6H8Y1-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
55814

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:55814

UCSC genome browser

More...
UCSCi
uc003kbp.2 human [A6H8Y1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF298151 mRNA Translation: AAG30220.1
AF298152 mRNA Translation: AAG30221.1
AJ238520 mRNA Translation: CAC04245.1
AJ278892 Genomic DNA Translation: CAC17771.1
AJ279120
, AJ279121, AJ279122, AJ279123, AJ279124, AJ279125, AJ279126, AJ279127, AJ279128, AJ279129, AJ279130, AJ279131, AJ279132, AJ279133, AJ279134, AJ279135, AJ279136, AJ279137, AJ279138, AJ279139, AJ279140, AJ279141, AJ279142, AJ279143, AJ279144, AJ279145, AJ279146, AJ279147, AJ279148, AJ279149, AJ279150 Genomic DNA Translation: CAC21448.1
AB033067 mRNA Translation: BAA86555.1 Different initiation.
AB051476 mRNA Translation: BAB21780.3 Different initiation.
BX641011 mRNA Translation: CAE46010.1
CR749229 mRNA Translation: CAH18085.1 Different initiation.
CR749289 mRNA Translation: CAH18144.1
AC138832 Genomic DNA No translation available.
BC032146 mRNA Translation: AAH32146.1 Sequence problems.
BC146792 mRNA Translation: AAI46793.1
AF176695 mRNA Translation: AAG09268.1 Frameshift.
AK057871 mRNA Translation: BAB71602.1
CCDSiCCDS43328.1 [A6H8Y1-1]
RefSeqiNP_060899.2, NM_018429.2 [A6H8Y1-1]
UniGeneiHs.258272

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5N9GX-ray2.70C/H241-396[»]
ProteinModelPortaliA6H8Y1
SMRiA6H8Y1
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120924, 43 interactors
CORUMiA6H8Y1
DIPiDIP-62076N
IntActiA6H8Y1, 17 interactors
STRINGi9606.ENSP00000351575

PTM databases

iPTMnetiA6H8Y1
PhosphoSitePlusiA6H8Y1

Polymorphism and mutation databases

BioMutaiBDP1

Proteomic databases

EPDiA6H8Y1
MaxQBiA6H8Y1
PaxDbiA6H8Y1
PRIDEiA6H8Y1
ProteomicsDBi777
778 [A6H8Y1-2]
779 [A6H8Y1-3]
780 [A6H8Y1-4]
781 [A6H8Y1-5]
782 [A6H8Y1-6]
783 [A6H8Y1-7]
784 [A6H8Y1-8]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000358731; ENSP00000351575; ENSG00000145734 [A6H8Y1-1]
ENST00000617085; ENSP00000482469; ENSG00000273873 [A6H8Y1-1]
GeneIDi55814
KEGGihsa:55814
UCSCiuc003kbp.2 human [A6H8Y1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
55814
DisGeNETi55814
EuPathDBiHostDB:ENSG00000145734.18

GeneCards: human genes, protein and diseases

More...
GeneCardsi
BDP1

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0004927
HGNCiHGNC:13652 BDP1
MalaCardsiBDP1
MIMi607012 gene
neXtProtiNX_A6H8Y1
OpenTargetsiENSG00000145734
Orphaneti90636 Autosomal recessive non-syndromic sensorineural deafness type DFNB
PharmGKBiPA25336

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2009 Eukaryota
COG5118 LUCA
GeneTreeiENSGT00390000012762
HOVERGENiHBG107497
KOiK15198
OMAiVKPVDEM
OrthoDBiEOG091G0GQF
PhylomeDBiA6H8Y1
TreeFamiTF328878

Enzyme and pathway databases

ReactomeiR-HSA-749476 RNA Polymerase III Abortive And Retractive Initiation
R-HSA-76061 RNA Polymerase III Transcription Initiation From Type 1 Promoter
R-HSA-76066 RNA Polymerase III Transcription Initiation From Type 2 Promoter
R-HSA-76071 RNA Polymerase III Transcription Initiation From Type 3 Promoter
SignaLinkiA6H8Y1
SIGNORiA6H8Y1

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
BDP1 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
BDP1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
55814

Protein Ontology

More...
PROi
PR:A6H8Y1

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000145734 Expressed in 210 organ(s), highest expression level in tendon
CleanExiHS_BDP1
ExpressionAtlasiA6H8Y1 baseline and differential
GenevisibleiA6H8Y1 HS

Family and domain databases

InterProiView protein in InterPro
IPR009057 Homeobox-like_sf
IPR001005 SANT/Myb
IPR030701 TFIIIB_B''
IPR039467 TFIIIB_B''_Myb
PANTHERiPTHR22929 PTHR22929, 4 hits
PfamiView protein in Pfam
PF15963 Myb_DNA-bind_7, 1 hit
SMARTiView protein in SMART
SM00717 SANT, 1 hit
SUPFAMiSSF46689 SSF46689, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiBDP1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A6H8Y1
Secondary accession number(s): Q68DS6
, Q68DY5, Q6MZL9, Q6PIM7, Q86W98, Q96LR8, Q9C0H4, Q9H197, Q9H1A1, Q9HAW1, Q9HAW2, Q9HCY0, Q9ULH9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: January 11, 2011
Last modified: December 5, 2018
This is version 105 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again