Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - A6H8M9 (CDHR4_HUMAN)

Entry version 107 (10 Feb 2021)
Sequence version 1 (24 Jul 2007)
Previous versions | rss
Add a publicationFeedback
Protein

Cadherin-related family member 4

Gene

CDHR4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell adhesion
LigandCalcium

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		A6H8M9

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cadherin-related family member 4
Alternative name(s):
Cadherin-like protein 29
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CDHR4
Synonyms:CDH29
ORF Names:UNQ9392/PRO34300
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:34527, CDHR4

neXtProt; the human protein knowledge platform

More...neXtProti		NX_A6H8M9

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000187492.8

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini17 – 686ExtracellularSequence analysisAdd BLAST670
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei687 – 707HelicalSequence analysisAdd BLAST21
Topological domaini708 – 788CytoplasmicSequence analysisAdd BLAST81

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		389118

Open Targets

More...OpenTargetsi		ENSG00000187492

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA165696944

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		A6H8M9, Tdark

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		CDHR4

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 16Sequence analysisAdd BLAST16
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000031997317 – 788Cadherin-related family member 4Add BLAST772

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi242N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		A6H8M9

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		A6H8M9

PeptideAtlas

More...PeptideAtlasi		A6H8M9

PRoteomics IDEntifications database

More...PRIDEi		A6H8M9

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		775 [A6H8M9-1]
776 [A6H8M9-2]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		A6H8M9, 1 site

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		A6H8M9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		A6H8M9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000187492, Expressed in right uterine tube and 83 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		A6H8M9, baseline and differential

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000187492, Tissue enhanced (epididymis, fallopian tube)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000391409

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		A6H8M9, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		A6H8M9

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini237 – 338Cadherin 1PROSITE-ProRule annotationAdd BLAST102
Domaini339 – 449Cadherin 2PROSITE-ProRule annotationAdd BLAST111
Domaini444 – 554Cadherin 3PROSITE-ProRule annotationAdd BLAST111
Domaini551 – 674Cadherin 4PROSITE-ProRule annotationAdd BLAST124

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1219, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000162824

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_382923_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		A6H8M9

Identification of Orthologs from Complete Genome Data

More...OMAi		APRMEMP

Database of Orthologous Groups

More...OrthoDBi		371149at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		A6H8M9

TreeFam database of animal gene trees

More...TreeFami		TF341878

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR002126, Cadherin-like_dom
IPR015919, Cadherin-like_sf
IPR020894, Cadherin_CS

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00028, Cadherin, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00205, CADHERIN

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00112, CA, 2 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF49313, SSF49313, 4 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00232, CADHERIN_1, 1 hit
PS50268, CADHERIN_2, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: A6H8M9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVLLRLLVFL FAPVVSDLCS LPCFINVSES QGPGTVLQFL SFNCSSYTPT 
        60         70         80         90        100
PTLELLNVQP PTTFFNPPSL ARWQGTYVGK LTLSSSAQLD ALMVNHYKVQ 
       110        120        130        140        150
LKFTCGNHVM EGSLSVDVQR DLSHIQCAGQ FASPAGEMIQ VPETVTPGAR 
       160        170        180        190        200
LYTLLLPGLE LHGAQMSIIS AQDLPHFPGP FSINEQGWLQ APSQGLLGQA 
       210        220        230        240        250
QKVFQLQISV SFGQRQSCQG MVIVKVLPVP SSQVSFLEQA QNITIPENLA 
       260        270        280        290        300
PGSEVVQVQA RGVDLRYEIL SPVPSPLFSI GRADGVVRTT TPLELARTSG 
       310        320        330        340        350
TAVSRLQVKA FEQGQLWASA KLNLTMNVQL VNLWPPRCLP ALLVSQIPET 
       360        370        380        390        400
APVGTVLNTL TCEDPDSVGA TLDYKLWFRS SSNPASLCLY DRVLEVNATL 
       410        420        430        440        450
DCDTPGACFQ HAASILVLDG GQPQMTTEVP VLVMVTPINE FSPACAPRTF 
       460        470        480        490        500
RVQEDAAPHT LLGSVVGTDM DYPHDNIEYY TSGGPTTFAV DRLSGEVHLL 
       510        520        530        540        550
GPLDYEQQRL YRLTVLVIDH GQDQNPNHHL SGSCTITIEV EDVNDHAPEC 
       560        570        580        590        600
EPPFQELTIY APLGRSVEVT KMSCQIPQEP QRLIYSYSIV GGNSQNRFIL 
       610        620        630        640        650
QGAILVHSDL VLGPFWPEQP RTYELLICVA DAGPSTPHLS TTATIIVHLV 
       660        670        680        690        700
PRRASTVATS THRTTVPSTM TPMLVTDTEA FWQPQPWFVV VLTATGALLL 
       710        720        730        740        750
LALGWLLGRL LQGLAQLLQA PSKPAQALLL NSIQGTEGSI EGFLEAPKME 
       760        770        780 
MSQAPSSVMS LHFDGRAQDS RTGRDYLFNT HTGARRWL
Length:788
Mass (Da):85,827
Last modified:July 24, 2007 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iAAC5C9F6908DBF67
GO
Isoform 2 (identifier: A6H8M9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     135-135: A → GEARGSRQGGGRHGLSRSSLTSTLASWGNDSGARDSHTWGSAVHSAPPRPRTPRSAGKPRTWDGG
     136-788: Missing.

Show »
Length:199
Mass (Da):21,388
Checksum:iD42B51E25AEC77AF
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7C4N6H7C4N6_HUMAN
Cadherin-related family member 4
CDHR4
134Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C5B2H7C5B2_HUMAN
Cadherin-related family member 4
CDHR4
151Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PFE8E9PFE8_HUMAN
Cadherin-related family member 4
CDHR4
184Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0391095R → K. Corresponds to variant dbSNP:rs13072748Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_031552135A → GEARGSRQGGGRHGLSRSSL TSTLASWGNDSGARDSHTWG SAVHSAPPRPRTPRSAGKPR TWDGG in isoform 2. 2 Publications1
Alternative sequenceiVSP_031553136 – 788Missing in isoform 2. 2 PublicationsAdd BLAST653

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AY358221 mRNA Translation: AAQ88588.1
BC132756 mRNA Translation: AAI32757.1
BC146674 mRNA Translation: AAI46675.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS46829.1 [A6H8M9-1]

NCBI Reference Sequences

More...RefSeqi		NP_001007541.2, NM_001007540.3 [A6H8M9-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000343366; ENSP00000341302; ENSG00000187492 [A6H8M9-2]
ENST00000412678; ENSP00000391409; ENSG00000187492 [A6H8M9-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		389118

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:389118

UCSC genome browser

More...UCSCi		uc003cxp.3, human [A6H8M9-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY358221 mRNA Translation: AAQ88588.1
BC132756 mRNA Translation: AAI32757.1
BC146674 mRNA Translation: AAI46675.1
CCDSiCCDS46829.1 [A6H8M9-1]
RefSeqiNP_001007541.2, NM_001007540.3 [A6H8M9-1]

3D structure databases

SMRiA6H8M9
ModBaseiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000391409

PTM databases

GlyGeniA6H8M9, 1 site
iPTMnetiA6H8M9
PhosphoSitePlusiA6H8M9

Genetic variation databases

BioMutaiCDHR4

Proteomic databases

MassIVEiA6H8M9
PaxDbiA6H8M9
PeptideAtlasiA6H8M9
PRIDEiA6H8M9
ProteomicsDBi775 [A6H8M9-1]
776 [A6H8M9-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		49593, 25 antibodies

The DNASU plasmid repository

More...DNASUi		389118

Genome annotation databases

EnsembliENST00000343366; ENSP00000341302; ENSG00000187492 [A6H8M9-2]
ENST00000412678; ENSP00000391409; ENSG00000187492 [A6H8M9-1]
GeneIDi389118
KEGGihsa:389118
UCSCiuc003cxp.3, human [A6H8M9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		389118
DisGeNETi389118

GeneCards: human genes, protein and diseases

More...GeneCardsi		CDHR4
HGNCiHGNC:34527, CDHR4
HPAiENSG00000187492, Tissue enhanced (epididymis, fallopian tube)
neXtProtiNX_A6H8M9
OpenTargetsiENSG00000187492
PharmGKBiPA165696944
VEuPathDBiHostDB:ENSG00000187492.8

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG1219, Eukaryota
GeneTreeiENSGT00940000162824
HOGENOMiCLU_382923_0_0_1
InParanoidiA6H8M9
OMAiAPRMEMP
OrthoDBi371149at2759
PhylomeDBiA6H8M9
TreeFamiTF341878

Enzyme and pathway databases

PathwayCommonsiA6H8M9

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		389118, 4 hits in 876 CRISPR screens

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		389118
PharosiA6H8M9, Tdark

Protein Ontology

More...PROi		PR:A6H8M9
RNActiA6H8M9, protein

Gene expression databases

BgeeiENSG00000187492, Expressed in right uterine tube and 83 other tissues
ExpressionAtlasiA6H8M9, baseline and differential

Family and domain databases

InterProiView protein in InterPro
IPR002126, Cadherin-like_dom
IPR015919, Cadherin-like_sf
IPR020894, Cadherin_CS
PfamiView protein in Pfam
PF00028, Cadherin, 1 hit
PRINTSiPR00205, CADHERIN
SMARTiView protein in SMART
SM00112, CA, 2 hits
SUPFAMiSSF49313, SSF49313, 4 hits
PROSITEiView protein in PROSITE
PS00232, CADHERIN_1, 1 hit
PS50268, CADHERIN_2, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCDHR4_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A6H8M9
Secondary accession number(s): Q6UXT0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: July 24, 2007
Last modified: February 10, 2021
This is version 107 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human variants curated from literature reports
    Index of human variants curated from literature reports
  2. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  3. Human entries with genetic variants
    List of human entries with genetic variants
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again