Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 95 (13 Feb 2019)
Sequence version 1 (24 Jul 2007)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Cadherin-related family member 4

Gene

CDHR4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

  • cell adhesion Source: GO_Central
  • homophilic cell adhesion via plasma membrane adhesion molecules Source: InterPro

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell adhesion
LigandCalcium

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cadherin-related family member 4
Alternative name(s):
Cadherin-like protein 29
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CDHR4
Synonyms:CDH29
ORF Names:UNQ9392/PRO34300
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000187492.8

Human Gene Nomenclature Database

More...
HGNCi
HGNC:34527 CDHR4

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_A6H8M9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini17 – 686ExtracellularSequence analysisAdd BLAST670
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei687 – 707HelicalSequence analysisAdd BLAST21
Topological domaini708 – 788CytoplasmicSequence analysisAdd BLAST81

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000187492

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA165696944

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CDHR4

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 16Sequence analysisAdd BLAST16
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000031997317 – 788Cadherin-related family member 4Add BLAST772

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi242N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
A6H8M9

PRoteomics IDEntifications database

More...
PRIDEi
A6H8M9

ProteomicsDB human proteome resource

More...
ProteomicsDBi
775
776 [A6H8M9-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
A6H8M9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
A6H8M9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000187492 Expressed in 68 organ(s), highest expression level in right uterine tube

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
A6H8M9 baseline and differential

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA076277

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000391409

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
A6H8M9

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
A6H8M9

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini237 – 338Cadherin 1PROSITE-ProRule annotationAdd BLAST102
Domaini339 – 449Cadherin 2PROSITE-ProRule annotationAdd BLAST111
Domaini444 – 554Cadherin 3PROSITE-ProRule annotationAdd BLAST111
Domaini551 – 674Cadherin 4PROSITE-ProRule annotationAdd BLAST124

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410ISUN Eukaryota
ENOG4110NJ5 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000162824

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000111287

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
A6H8M9

KEGG Orthology (KO)

More...
KOi
K16504

Identification of Orthologs from Complete Genome Data

More...
OMAi
VTKVSCW

Database of Orthologous Groups

More...
OrthoDBi
371149at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
A6H8M9

TreeFam database of animal gene trees

More...
TreeFami
TF341878

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002126 Cadherin-like_dom
IPR015919 Cadherin-like_sf
IPR020894 Cadherin_CS

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00028 Cadherin, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00205 CADHERIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00112 CA, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49313 SSF49313, 4 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00232 CADHERIN_1, 1 hit
PS50268 CADHERIN_2, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: A6H8M9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVLLRLLVFL FAPVVSDLCS LPCFINVSES QGPGTVLQFL SFNCSSYTPT
60 70 80 90 100
PTLELLNVQP PTTFFNPPSL ARWQGTYVGK LTLSSSAQLD ALMVNHYKVQ
110 120 130 140 150
LKFTCGNHVM EGSLSVDVQR DLSHIQCAGQ FASPAGEMIQ VPETVTPGAR
160 170 180 190 200
LYTLLLPGLE LHGAQMSIIS AQDLPHFPGP FSINEQGWLQ APSQGLLGQA
210 220 230 240 250
QKVFQLQISV SFGQRQSCQG MVIVKVLPVP SSQVSFLEQA QNITIPENLA
260 270 280 290 300
PGSEVVQVQA RGVDLRYEIL SPVPSPLFSI GRADGVVRTT TPLELARTSG
310 320 330 340 350
TAVSRLQVKA FEQGQLWASA KLNLTMNVQL VNLWPPRCLP ALLVSQIPET
360 370 380 390 400
APVGTVLNTL TCEDPDSVGA TLDYKLWFRS SSNPASLCLY DRVLEVNATL
410 420 430 440 450
DCDTPGACFQ HAASILVLDG GQPQMTTEVP VLVMVTPINE FSPACAPRTF
460 470 480 490 500
RVQEDAAPHT LLGSVVGTDM DYPHDNIEYY TSGGPTTFAV DRLSGEVHLL
510 520 530 540 550
GPLDYEQQRL YRLTVLVIDH GQDQNPNHHL SGSCTITIEV EDVNDHAPEC
560 570 580 590 600
EPPFQELTIY APLGRSVEVT KMSCQIPQEP QRLIYSYSIV GGNSQNRFIL
610 620 630 640 650
QGAILVHSDL VLGPFWPEQP RTYELLICVA DAGPSTPHLS TTATIIVHLV
660 670 680 690 700
PRRASTVATS THRTTVPSTM TPMLVTDTEA FWQPQPWFVV VLTATGALLL
710 720 730 740 750
LALGWLLGRL LQGLAQLLQA PSKPAQALLL NSIQGTEGSI EGFLEAPKME
760 770 780
MSQAPSSVMS LHFDGRAQDS RTGRDYLFNT HTGARRWL
Length:788
Mass (Da):85,827
Last modified:July 24, 2007 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iAAC5C9F6908DBF67
GO
Isoform 2 (identifier: A6H8M9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     135-135: A → GEARGSRQGGGRHGLSRSSLTSTLASWGNDSGARDSHTWGSAVHSAPPRPRTPRSAGKPRTWDGG
     136-788: Missing.

Show »
Length:199
Mass (Da):21,388
Checksum:iD42B51E25AEC77AF
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7C5B2H7C5B2_HUMAN
Cadherin-related family member 4
CDHR4
151Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C4N6H7C4N6_HUMAN
Cadherin-related family member 4
CDHR4
134Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PFE8E9PFE8_HUMAN
Cadherin-related family member 4
CDHR4
184Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0391095R → K. Corresponds to variant dbSNP:rs13072748Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_031552135A → GEARGSRQGGGRHGLSRSSL TSTLASWGNDSGARDSHTWG SAVHSAPPRPRTPRSAGKPR TWDGG in isoform 2. 2 Publications1
Alternative sequenceiVSP_031553136 – 788Missing in isoform 2. 2 PublicationsAdd BLAST653

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY358221 mRNA Translation: AAQ88588.1
BC132756 mRNA Translation: AAI32757.1
BC146674 mRNA Translation: AAI46675.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS46829.1 [A6H8M9-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001007541.2, NM_001007540.3 [A6H8M9-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.363312

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000343366; ENSP00000341302; ENSG00000187492 [A6H8M9-2]
ENST00000412678; ENSP00000391409; ENSG00000187492 [A6H8M9-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
389118

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:389118

UCSC genome browser

More...
UCSCi
uc003cxp.3 human [A6H8M9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY358221 mRNA Translation: AAQ88588.1
BC132756 mRNA Translation: AAI32757.1
BC146674 mRNA Translation: AAI46675.1
CCDSiCCDS46829.1 [A6H8M9-1]
RefSeqiNP_001007541.2, NM_001007540.3 [A6H8M9-1]
UniGeneiHs.363312

3D structure databases

ProteinModelPortaliA6H8M9
SMRiA6H8M9
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000391409

PTM databases

iPTMnetiA6H8M9
PhosphoSitePlusiA6H8M9

Polymorphism and mutation databases

BioMutaiCDHR4

Proteomic databases

PaxDbiA6H8M9
PRIDEiA6H8M9
ProteomicsDBi775
776 [A6H8M9-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
389118
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000343366; ENSP00000341302; ENSG00000187492 [A6H8M9-2]
ENST00000412678; ENSP00000391409; ENSG00000187492 [A6H8M9-1]
GeneIDi389118
KEGGihsa:389118
UCSCiuc003cxp.3 human [A6H8M9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
389118
EuPathDBiHostDB:ENSG00000187492.8

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CDHR4
HGNCiHGNC:34527 CDHR4
HPAiHPA076277
neXtProtiNX_A6H8M9
OpenTargetsiENSG00000187492
PharmGKBiPA165696944

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410ISUN Eukaryota
ENOG4110NJ5 LUCA
GeneTreeiENSGT00940000162824
HOGENOMiHOG000111287
InParanoidiA6H8M9
KOiK16504
OMAiVTKVSCW
OrthoDBi371149at2759
PhylomeDBiA6H8M9
TreeFamiTF341878

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
389118

Protein Ontology

More...
PROi
PR:A6H8M9

Gene expression databases

BgeeiENSG00000187492 Expressed in 68 organ(s), highest expression level in right uterine tube
ExpressionAtlasiA6H8M9 baseline and differential

Family and domain databases

InterProiView protein in InterPro
IPR002126 Cadherin-like_dom
IPR015919 Cadherin-like_sf
IPR020894 Cadherin_CS
PfamiView protein in Pfam
PF00028 Cadherin, 1 hit
PRINTSiPR00205 CADHERIN
SMARTiView protein in SMART
SM00112 CA, 2 hits
SUPFAMiSSF49313 SSF49313, 4 hits
PROSITEiView protein in PROSITE
PS00232 CADHERIN_1, 1 hit
PS50268 CADHERIN_2, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCDHR4_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A6H8M9
Secondary accession number(s): Q6UXT0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: July 24, 2007
Last modified: February 13, 2019
This is version 95 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again