Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 93 (08 May 2019)
Sequence version 1 (24 Jul 2007)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Rab GTPase-activating protein 1-like

Gene

Rabgap1l

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

GTP-hydrolysis activating protein (GAP) for small GTPase RAB22A, converting active RAB22A-GTP to the inactive form RAB22A-GDP (By similarity). Plays a role in endocytosis and intracellular protein transport. Recruited by ANK2 to phosphatidylinositol 3-phosphate (PI3P)-positive early endosomes, where it inactivates RAB22A, and promotes polarized trafficking to the leading edge of the migrating cells. Part of the ANK2/RABGAP1L complex which is required for the polarized recycling of fibronectin receptor ITGA5 ITGB1 to the plasma membrane that enables continuous directional cell migration (PubMed:27718357).By similarity1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei580Arginine fingerBy similarity1
Sitei621Glutamine fingerBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGTPase activation
Biological processEndocytosis, Protein transport, Transport

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Rab GTPase-activating protein 1-like
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Rabgap1lImported
Synonyms:HhlImported, Kiaa0471Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1352507 Rabgap1l

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Endosome, Golgi apparatus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi584R → A: Loss GTPase-activating (GAP) activity. 1 Publication1
Mutagenesisi784 – 785KK → EE: Loss of interaction with ANK2. Loss of colocalization and cotransportation on motile vesicles with ANK2. 1 Publication2

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003480551 – 815Rab GTPase-activating protein 1-likeAdd BLAST815

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei471PhosphothreonineBy similarity1
Modified residuei480PhosphoserineBy similarity1
Modified residuei490PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
A6H6A9

MaxQB - The MaxQuant DataBase

More...
MaxQBi
A6H6A9

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
A6H6A9

PeptideAtlas

More...
PeptideAtlasi
A6H6A9

PRoteomics IDEntifications database

More...
PRIDEi
A6H6A9

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
A6H6A9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
A6H6A9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in embryonic heart and liver, and in hemopoietic cells (PubMed:10585558). Expressed in the corpus callosum in the central nervous system (CNS) and costameres in skeletal muscle at postnatal day (PND) 30 (PubMed:27718357).2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000026721 Expressed in 276 organ(s), highest expression level in CA1 field of hippocampus

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
A6H6A9 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
A6H6A9 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (via Rab-GAP TBC domain) with ANK2 (via death domain).1 Publication

GO - Molecular functioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000028049

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
A6H6A9

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini126 – 282PIDPROSITE-ProRule annotationAdd BLAST157
Domaini538 – 724Rab-GAP TBCPROSITE-ProRule annotationAdd BLAST187

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The arginine and glutamine fingers are critical for the GTPase-activating mechanism, they pull out Rab's 'switch 2' glutamine and insert in Rab's active site.By similarity

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1102 Eukaryota
COG5210 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154611

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
A6H6A9

KEGG Orthology (KO)

More...
KOi
K20284

Identification of Orthologs from Complete Genome Data

More...
OMAi
RDLYRNN

Database of Orthologous Groups

More...
OrthoDBi
191811at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
A6H6A9

TreeFam database of animal gene trees

More...
TreeFami
TF317184

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR022164 Kinesin-like
IPR011993 PH-like_dom_sf
IPR006020 PTB/PI_dom
IPR000195 Rab-GTPase-TBC_dom
IPR035969 Rab-GTPase_TBC_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12473 DUF3694, 1 hit
PF00566 RabGAP-TBC, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00462 PTB, 1 hit
SM00164 TBC, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47923 SSF47923, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS01179 PID, 1 hit
PS50086 TBC_RABGAP, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 12 Publications (identifier: A6H6A9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEVRASFQKV SGSSDSVATL NSEEFVLVSQ HTDATSIKDD GKPQLKIASN
60 70 80 90 100
GDEQLEKAME EILRDSEKGQ SGLPVDCQGS SEISDCPFGD VPASQTTKPP
110 120 130 140 150
LQLILDPSNT EISTPRPSSP SRFPEEDSVL FNKLTYLGCM KVSSPRSEVE
160 170 180 190 200
ALRAMATMRA SSQYPFAVTL YVPNVPEGSV RIIDQSSNVE IASFPIYKVL
210 220 230 240 250
FCARGHDGTA ESNCFAFTES SHGSEEFQIH VFSCEIKEAV SRILYSFCTA
260 270 280 290 300
FKRSSRQVSD VKDSVIPTPD SDVFTFSVSL EVKEDDGKGN FSPVPKDRDK
310 320 330 340 350
FYFKIKQGIE KKVVITVQQL SNKELAIERC FGMLLSPGRN VKNSDMHLLD
360 370 380 390 400
MESMGKSYDG RAYVITGMWN PNAPIFLALN EETPKDKRVY MTVAVDMVVT
410 420 430 440 450
EVVEPVRFLL ETVVRVYPAN ERFWYFSRKT FTETFFMRLK QSEGKGHSSA
460 470 480 490 500
GDAIYEVVSL QRESDKEEPI TPTSAGGPMS PQEDEAEEES DNELSSGTGD
510 520 530 540 550
VSKDCPEKIL YSWGELLGRW HNNLGGRPKG LFTLVKSGVP EALRAEVWQL
560 570 580 590 600
LAGCHDNQEM LDKYRILITK DSAQESVITR DIHRTFPAHD YFKDTGGDGQ
610 620 630 640 650
ESLYKICKAY SVFDEDIGYC QGQSFLAAVL LLHMPEEQAF CVLVTIMYGY
660 670 680 690 700
KLRDLYRNNF EDLHCKFYQL EKLMQEQLPD LYSHFCDLNL EAHMYASQWF
710 720 730 740 750
LTLFTAKFPL CMVFHIIDLL LCEGLNIIFH VALALLKTSK EDLLQADFEG
760 770 780 790 800
ALKFFRVQLP KRYRAEENAR RLMEQACNIK VPTKKLKKYE KEYQAMRENQ
810
LQQEDPMDRY KFVYL
Length:815
Mass (Da):92,404
Last modified:July 24, 2007 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i28AA916BF9BA3F0E
GO
Isoform 21 Publication (identifier: A6H6A9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: MEVRASFQKVSGSSDSVATLNSEEFVLVSQ → ME
     489-505: ESDNELSSGTGDVSKDC → DPGHASPDTVGFLTLFL
     506-815: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:477
Mass (Da):53,068
Checksum:iDB28B8D4939AC348
GO
Isoform 32 Publications (identifier: A6H6A9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-681: Missing.
     682-737: YSHFCDLNLE...IFHVALALLK → MEEGVPCPAP...HRLFVPRLLA
     812-815: FVYL → RENRRLQEAS...QAPQPPKEST

Show »
Length:370
Mass (Da):42,754
Checksum:iF5C6214242E789B9
GO
Isoform 41 Publication (identifier: A6H6A9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-743: Missing.
     744-780: LQADFEGALKFFRVQLPKRYRAEENARRLMEQACNIK → MMEEISIMVAYDAHVFSQLHDEDFLTSLVATSKPRSM

Show »
Length:72
Mass (Da):8,652
Checksum:iF3D99B7B2FEAF43B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A6YY35A0A0A6YY35_MOUSE
Rab GTPase-activating protein 1-lik...
Rabgap1l
234Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3Q4L343A0A3Q4L343_MOUSE
Rab GTPase-activating protein 1-lik...
Rabgap1l
198Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A6YWT4A0A0A6YWT4_MOUSE
Rab GTPase-activating protein 1-lik...
Rabgap1l
230Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A6YW18A0A0A6YW18_MOUSE
Rab GTPase-activating protein 1-lik...
Rabgap1l
107Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A6YWY0A0A0A6YWY0_MOUSE
Rab GTPase-activating protein 1-lik...
Rabgap1l
147Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A6YX13A0A0A6YX13_MOUSE
Rab GTPase-activating protein 1-lik...
Rabgap1l
59Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAF24092 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence AAF24092 differs from that shown. Reason: Frameshift at positions 145, 153, 156 and 354.Curated
The sequence AAF24092 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti4R → G in AAF24092 (PubMed:10585558).Curated1
Sequence conflicti108S → C in BAC29189 (PubMed:16141072).Curated1
Sequence conflicti208G → E in AAF24092 (PubMed:10585558).Curated1
Sequence conflicti303F → I in AAF24092 (PubMed:10585558).Curated1
Sequence conflicti384 – 386PKD → LSQ in AAF24092 (PubMed:10585558).Curated3

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0529251 – 743Missing in isoform 4. 1 PublicationAdd BLAST743
Alternative sequenceiVSP_0529261 – 681Missing in isoform 3. 2 PublicationsAdd BLAST681
Alternative sequenceiVSP_0529271 – 30MEVRA…VLVSQ → ME in isoform 2. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_052928489 – 505ESDNE…VSKDC → DPGHASPDTVGFLTLFL in isoform 2. 1 PublicationAdd BLAST17
Alternative sequenceiVSP_052929506 – 815Missing in isoform 2. 1 PublicationAdd BLAST310
Alternative sequenceiVSP_052930682 – 737YSHFC…LALLK → MEEGVPCPAPAAKLTPPVKK SQDMHDERSKLVNEYACRVL ELLGMGHRLFVPRLLA in isoform 3. 2 PublicationsAdd BLAST56
Alternative sequenceiVSP_052931744 – 780LQADF…ACNIK → MMEEISIMVAYDAHVFSQLH DEDFLTSLVATSKPRSM in isoform 4. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_052932812 – 815FVYL → RENRRLQEASMRLEQENDDL AHELVTSKIALRNDLDQAED KADVLNKELLFTKQRLVETE EEKRKQEEETAQLKEVFRKQ LEKAEYEIKKTTAIIAEYKQ ICSQLSTRLEKQQAASKEEL EAVKGKMMACKHCSDIFSKE GALKPVAVNREDQGLEADDE KDSLKKQLREMELELAQTKL QLVEAKCKIQELEHQRGALM NEIQAAKNSWFSKTLNSIKT ATGTQPLQPPQAPQPPKEST in isoform 3. 2 Publications4

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK034019 mRNA Translation: BAC28549.1
AK035796 mRNA Translation: BAC29189.1
AK147634 mRNA Translation: BAE28037.1
BC038651 mRNA Translation: AAH38651.1
BC145811 mRNA Translation: AAI45812.1
BC145813 mRNA Translation: AAI45814.1
AF118565 mRNA Translation: AAF24092.1 Sequence problems.
AK122292 mRNA Translation: BAC65574.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS15407.1 [A6H6A9-3]
CCDS15408.1 [A6H6A9-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001033710.1, NM_001038621.2 [A6H6A9-3]
NP_038890.3, NM_013862.5 [A6H6A9-1]
XP_006496946.1, XM_006496883.3 [A6H6A9-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000028049; ENSMUSP00000028049; ENSMUSG00000026721 [A6H6A9-1]
ENSMUST00000028052; ENSMUSP00000028052; ENSMUSG00000026721 [A6H6A9-3]
ENSMUST00000195442; ENSMUSP00000141666; ENSMUSG00000026721 [A6H6A9-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
29809

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:29809

UCSC genome browser

More...
UCSCi
uc007deh.1 mouse [A6H6A9-3]
uc007dej.2 mouse [A6H6A9-1]
uc007dek.1 mouse [A6H6A9-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK034019 mRNA Translation: BAC28549.1
AK035796 mRNA Translation: BAC29189.1
AK147634 mRNA Translation: BAE28037.1
BC038651 mRNA Translation: AAH38651.1
BC145811 mRNA Translation: AAI45812.1
BC145813 mRNA Translation: AAI45814.1
AF118565 mRNA Translation: AAF24092.1 Sequence problems.
AK122292 mRNA Translation: BAC65574.1
CCDSiCCDS15407.1 [A6H6A9-3]
CCDS15408.1 [A6H6A9-1]
RefSeqiNP_001033710.1, NM_001038621.2 [A6H6A9-3]
NP_038890.3, NM_013862.5 [A6H6A9-1]
XP_006496946.1, XM_006496883.3 [A6H6A9-4]

3D structure databases

SMRiA6H6A9
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000028049

PTM databases

iPTMnetiA6H6A9
PhosphoSitePlusiA6H6A9

Proteomic databases

EPDiA6H6A9
MaxQBiA6H6A9
PaxDbiA6H6A9
PeptideAtlasiA6H6A9
PRIDEiA6H6A9

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000028049; ENSMUSP00000028049; ENSMUSG00000026721 [A6H6A9-1]
ENSMUST00000028052; ENSMUSP00000028052; ENSMUSG00000026721 [A6H6A9-3]
ENSMUST00000195442; ENSMUSP00000141666; ENSMUSG00000026721 [A6H6A9-2]
GeneIDi29809
KEGGimmu:29809
UCSCiuc007deh.1 mouse [A6H6A9-3]
uc007dej.2 mouse [A6H6A9-1]
uc007dek.1 mouse [A6H6A9-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9910
MGIiMGI:1352507 Rabgap1l

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiKOG1102 Eukaryota
COG5210 LUCA
GeneTreeiENSGT00940000154611
InParanoidiA6H6A9
KOiK20284
OMAiRDLYRNN
OrthoDBi191811at2759
PhylomeDBiA6H6A9
TreeFamiTF317184

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Rabgap1l mouse

Protein Ontology

More...
PROi
PR:A6H6A9

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000026721 Expressed in 276 organ(s), highest expression level in CA1 field of hippocampus
ExpressionAtlasiA6H6A9 baseline and differential
GenevisibleiA6H6A9 MM

Family and domain databases

Gene3Di2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR022164 Kinesin-like
IPR011993 PH-like_dom_sf
IPR006020 PTB/PI_dom
IPR000195 Rab-GTPase-TBC_dom
IPR035969 Rab-GTPase_TBC_sf
PfamiView protein in Pfam
PF12473 DUF3694, 1 hit
PF00566 RabGAP-TBC, 1 hit
SMARTiView protein in SMART
SM00462 PTB, 1 hit
SM00164 TBC, 1 hit
SUPFAMiSSF47923 SSF47923, 2 hits
PROSITEiView protein in PROSITE
PS01179 PID, 1 hit
PS50086 TBC_RABGAP, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRBG1L_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A6H6A9
Secondary accession number(s): Q3UH20
, Q80TZ4, Q8BZD2, Q8BZP0, Q8CFI6, Q9QY69
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 2, 2008
Last sequence update: July 24, 2007
Last modified: May 8, 2019
This is version 93 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again