Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

5-hydroxytryptamine receptor 3E

Gene

HTR3E

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor is a ligand-gated ion channel, which when activated causes fast, depolarizing responses. It is a cation-specific, but otherwise relatively nonselective, ion channel.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionIon channel, Ligand-gated ion channel, Receptor
Biological processIon transport, Transport

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-112314 Neurotransmitter receptors and postsynaptic signal transmission

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
5-hydroxytryptamine receptor 3E
Short name:
5-HT3-E
Short name:
5-HT3E
Alternative name(s):
Serotonin receptor 3E
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:HTR3E
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000186038.9

Human Gene Nomenclature Database

More...
HGNCi
HGNC:24005 HTR3E

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
610123 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_A5X5Y0

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini26 – 248ExtracellularSequence analysisAdd BLAST223
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei249 – 269Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini270 – 282CytoplasmicSequence analysisAdd BLAST13
Transmembranei283 – 303Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini304 – 307ExtracellularSequence analysis4
Transmembranei308 – 328Helical; Name=3Sequence analysisAdd BLAST21
Topological domaini329 – 433CytoplasmicSequence analysisAdd BLAST105
Transmembranei434 – 454Helical; Name=4Sequence analysisAdd BLAST21
Topological domaini455 – 456ExtracellularSequence analysis2

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
285242

Open Targets

More...
OpenTargetsi
ENSG00000186038

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134900226

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL2094132

Drug and drug target database

More...
DrugBanki
DB01049 Ergoloid mesylate
DB00898 Ethanol
DB13025 Tiapride

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
HTR3E

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 25Sequence analysisAdd BLAST25
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000031229426 – 4565-hydroxytryptamine receptor 3EAdd BLAST431

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi162 ↔ 176By similarity
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi175N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
A5X5Y0

PRoteomics IDEntifications database

More...
PRIDEi
A5X5Y0

ProteomicsDB human proteome resource

More...
ProteomicsDBi
750
751 [A5X5Y0-2]
752 [A5X5Y0-3]
753 [A5X5Y0-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
A5X5Y0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
A5X5Y0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in adult colon and intestine.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000186038 Expressed in 7 organ(s), highest expression level in mucosa of transverse colon

CleanEx database of gene expression profiles

More...
CleanExi
HS_HTR3E

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
A5X5Y0 baseline and differential

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA049764

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Forms a pentaheteromeric complex with HTR3A. Not functional as a homomeric complex.1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
HTR3AP460985EBI-11174612,EBI-9008743

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
130056, 6 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-273 5-hydroxytryptamine-3A/E receptor complex

Protein interaction database and analysis system

More...
IntActi
A5X5Y0, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000335511

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
A5X5Y0

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
A5X5Y0

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
A5X5Y0

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3645 Eukaryota
ENOG410XQGR LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000163899

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000241519

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG106638

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
A5X5Y0

KEGG Orthology (KO)

More...
KOi
K04819

Identification of Orthologs from Complete Genome Data

More...
OMAi
EFMDVDK

Database of Orthologous Groups

More...
OrthoDBi
123230at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
A5X5Y0

TreeFam database of animal gene trees

More...
TreeFami
TF315605

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.70.170.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR006202 Neur_chan_lig-bd
IPR036734 Neur_chan_lig-bd_sf
IPR006201 Neur_channel
IPR036719 Neuro-gated_channel_TM_sf
IPR006029 Neurotrans-gated_channel_TM
IPR018000 Neurotransmitter_ion_chnl_CS

The PANTHER Classification System

More...
PANTHERi
PTHR18945 PTHR18945, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02931 Neur_chan_LBD, 1 hit
PF02932 Neur_chan_memb, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00252 NRIONCHANNEL

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF63712 SSF63712, 1 hit
SSF90112 SSF90112, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00236 NEUROTR_ION_CHANNEL, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: A5X5Y0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEGSWFHRKR FSFYLLLGFL LQGRGVTFTI NCSGFGQHGA DPTALNSVFN
60 70 80 90 100
RKPFRPVTNI SVPTQVNISF AMSAILDVNE QLHLLSSFLW LEMVWDNPFI
110 120 130 140 150
SWNPEECEGI TKMSMAAKNL WLPDIFIIEL MDVDKTPKGL TAYVSNEGRI
160 170 180 190 200
RYKKPMKVDS ICNLDIFYFP FDQQNCTLTF SSFLYTVDSM LLDMEKEVWE
210 220 230 240 250
ITDASRNILQ THGEWELLGL SKATAKLSRG GNLYDQIVFY VAIRRRPSLY
260 270 280 290 300
VINLLVPSGF LVAIDALSFY LPVKSGNRVP FKITLLLGYN VFLLMMSDLL
310 320 330 340 350
PTSGTPLIGV YFALCLSLMV GSLLETIFIT HLLHVATTQP PPLPRWLHSL
360 370 380 390 400
LLHCNSPGRC CPTAPQKENK GPGLTPTHLP GVKEPEVSAG QMPGPAEAEL
410 420 430 440 450
TGGSEWTRAQ REHEAQKQHS VELWLQFSHA MDAMLFRLYL LFMASSIITV

ICLWNT
Length:456
Mass (Da):51,438
Last modified:July 10, 2007 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4BFA6561BA309E83
GO
Isoform 2 (identifier: A5X5Y0-2) [UniParc]FASTAAdd to basket
Also known as: 5-HT3c1

The sequence of this isoform differs from the canonical sequence as follows:
     79-93: Missing.

Show »
Length:441
Mass (Da):49,596
Checksum:iF604941E9F3849D6
GO
Isoform 3 (identifier: A5X5Y0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-22: MEGSWFHRKRFSFYLLLGFLLQ → MLAFILSRATPRPALGPLSYREHRVALLHLTHSMSTT

Show »
Length:471
Mass (Da):52,808
Checksum:i94A7B8D13492E8F1
GO
Isoform 4 (identifier: A5X5Y0-4) [UniParc]FASTAAdd to basket
Also known as: 5-HT3c1 long

The sequence of this isoform differs from the canonical sequence as follows:
     1-22: MEGSWFHRKRFSFYLLLGFLLQ → MLAFILSRATPRPALGPLSYREHRVALLHLTHSMSTT
     79-93: Missing.

Show »
Length:456
Mass (Da):50,965
Checksum:i81FD94F996ED344D
GO
Isoform 5 (identifier: A5X5Y0-6) [UniParc]FASTAAdd to basket
Also known as: HTR3E_V3

The sequence of this isoform differs from the canonical sequence as follows:
     1-22: MEGSWFHRKRFSFYLLLGFLLQ → MLAFILSRATPRPALGPLSYREHRVALLHLTHSMSTT
     79-93: Missing.
     129-129: E → ELCVSRAGQREVPSPGSHRDHSLPLGP

Show »
Length:482
Mass (Da):53,700
Checksum:iDDE59C2099D78219
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9J420C9J420_HUMAN
5-hydroxytryptamine receptor 3E
HTR3E
158Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti44A → T in AAI01183 (PubMed:15489334).Curated1
Sequence conflicti44A → T in AAI01184 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03748171A → T1 PublicationCorresponds to variant dbSNP:rs7627615Ensembl.1
Natural variantiVAR_037482430A → T. Corresponds to variant dbSNP:rs13324468Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0298031 – 22MEGSW…GFLLQ → MLAFILSRATPRPALGPLSY REHRVALLHLTHSMSTT in isoform 3, isoform 4 and isoform 5. 5 PublicationsAdd BLAST22
Alternative sequenceiVSP_02980479 – 93Missing in isoform 2, isoform 4 and isoform 5. 2 PublicationsAdd BLAST15
Alternative sequenceiVSP_045573129E → ELCVSRAGQREVPSPGSHRD HSLPLGP in isoform 5. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY349352 mRNA Translation: AAQ93476.1
AY349353 mRNA Translation: AAQ93477.1
AY159813 mRNA Translation: AAO38167.2
DQ644022 mRNA Translation: ABG35128.1
EU165354 mRNA Translation: ABW05298.1
AC131235 Genomic DNA No translation available.
BC101182 mRNA Translation: AAI01183.1
BC101183 mRNA Translation: AAI01184.1
BC101185 mRNA Translation: AAI01186.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS3251.1 [A5X5Y0-3]
CCDS58868.1 [A5X5Y0-1]
CCDS58869.1 [A5X5Y0-2]
CCDS58870.1 [A5X5Y0-4]
CCDS58871.1 [A5X5Y0-6]

NCBI Reference Sequences

More...
RefSeqi
NP_001243542.1, NM_001256613.1 [A5X5Y0-1]
NP_001243543.1, NM_001256614.1 [A5X5Y0-6]
NP_872395.2, NM_182589.2 [A5X5Y0-3]
NP_938055.1, NM_198313.2 [A5X5Y0-2]
NP_938056.1, NM_198314.2 [A5X5Y0-4]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.449179

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000335304; ENSP00000335511; ENSG00000186038 [A5X5Y0-3]
ENST00000415389; ENSP00000401444; ENSG00000186038 [A5X5Y0-1]
ENST00000425359; ENSP00000401900; ENSG00000186038 [A5X5Y0-2]
ENST00000436361; ENSP00000395833; ENSG00000186038 [A5X5Y0-4]
ENST00000440596; ENSP00000406050; ENSG00000186038 [A5X5Y0-6]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
285242

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:285242

UCSC genome browser

More...
UCSCi
uc003fml.5 human [A5X5Y0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY349352 mRNA Translation: AAQ93476.1
AY349353 mRNA Translation: AAQ93477.1
AY159813 mRNA Translation: AAO38167.2
DQ644022 mRNA Translation: ABG35128.1
EU165354 mRNA Translation: ABW05298.1
AC131235 Genomic DNA No translation available.
BC101182 mRNA Translation: AAI01183.1
BC101183 mRNA Translation: AAI01184.1
BC101185 mRNA Translation: AAI01186.1
CCDSiCCDS3251.1 [A5X5Y0-3]
CCDS58868.1 [A5X5Y0-1]
CCDS58869.1 [A5X5Y0-2]
CCDS58870.1 [A5X5Y0-4]
CCDS58871.1 [A5X5Y0-6]
RefSeqiNP_001243542.1, NM_001256613.1 [A5X5Y0-1]
NP_001243543.1, NM_001256614.1 [A5X5Y0-6]
NP_872395.2, NM_182589.2 [A5X5Y0-3]
NP_938055.1, NM_198313.2 [A5X5Y0-2]
NP_938056.1, NM_198314.2 [A5X5Y0-4]
UniGeneiHs.449179

3D structure databases

ProteinModelPortaliA5X5Y0
SMRiA5X5Y0
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi130056, 6 interactors
ComplexPortaliCPX-273 5-hydroxytryptamine-3A/E receptor complex
IntActiA5X5Y0, 1 interactor
STRINGi9606.ENSP00000335511

Chemistry databases

BindingDBiA5X5Y0
ChEMBLiCHEMBL2094132
DrugBankiDB01049 Ergoloid mesylate
DB00898 Ethanol
DB13025 Tiapride

PTM databases

iPTMnetiA5X5Y0
PhosphoSitePlusiA5X5Y0

Polymorphism and mutation databases

BioMutaiHTR3E

Proteomic databases

PaxDbiA5X5Y0
PRIDEiA5X5Y0
ProteomicsDBi750
751 [A5X5Y0-2]
752 [A5X5Y0-3]
753 [A5X5Y0-4]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000335304; ENSP00000335511; ENSG00000186038 [A5X5Y0-3]
ENST00000415389; ENSP00000401444; ENSG00000186038 [A5X5Y0-1]
ENST00000425359; ENSP00000401900; ENSG00000186038 [A5X5Y0-2]
ENST00000436361; ENSP00000395833; ENSG00000186038 [A5X5Y0-4]
ENST00000440596; ENSP00000406050; ENSG00000186038 [A5X5Y0-6]
GeneIDi285242
KEGGihsa:285242
UCSCiuc003fml.5 human [A5X5Y0-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
285242
DisGeNETi285242
EuPathDBiHostDB:ENSG00000186038.9

GeneCards: human genes, protein and diseases

More...
GeneCardsi
HTR3E
HGNCiHGNC:24005 HTR3E
HPAiHPA049764
MIMi610123 gene
neXtProtiNX_A5X5Y0
OpenTargetsiENSG00000186038
PharmGKBiPA134900226

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3645 Eukaryota
ENOG410XQGR LUCA
GeneTreeiENSGT00940000163899
HOGENOMiHOG000241519
HOVERGENiHBG106638
InParanoidiA5X5Y0
KOiK04819
OMAiEFMDVDK
OrthoDBi123230at2759
PhylomeDBiA5X5Y0
TreeFamiTF315605

Enzyme and pathway databases

ReactomeiR-HSA-112314 Neurotransmitter receptors and postsynaptic signal transmission

Miscellaneous databases

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
HTR3E

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
285242

Protein Ontology

More...
PROi
PR:A5X5Y0

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000186038 Expressed in 7 organ(s), highest expression level in mucosa of transverse colon
CleanExiHS_HTR3E
ExpressionAtlasiA5X5Y0 baseline and differential

Family and domain databases

Gene3Di2.70.170.10, 1 hit
InterProiView protein in InterPro
IPR006202 Neur_chan_lig-bd
IPR036734 Neur_chan_lig-bd_sf
IPR006201 Neur_channel
IPR036719 Neuro-gated_channel_TM_sf
IPR006029 Neurotrans-gated_channel_TM
IPR018000 Neurotransmitter_ion_chnl_CS
PANTHERiPTHR18945 PTHR18945, 1 hit
PfamiView protein in Pfam
PF02931 Neur_chan_LBD, 1 hit
PF02932 Neur_chan_memb, 1 hit
PRINTSiPR00252 NRIONCHANNEL
SUPFAMiSSF63712 SSF63712, 1 hit
SSF90112 SSF90112, 1 hit
PROSITEiView protein in PROSITE
PS00236 NEUROTR_ION_CHANNEL, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry namei5HT3E_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A5X5Y0
Secondary accession number(s): A8IKD7
, E9PGF1, Q495G1, Q495G3, Q6V706, Q6V707, Q7Z6B2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 4, 2007
Last sequence update: July 10, 2007
Last modified: January 16, 2019
This is version 114 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again