Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 83 (13 Feb 2019)
Sequence version 1 (10 Jul 2007)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Regulator of G-protein signaling protein-like

Gene

RGSL1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-416476 G alpha (q) signalling events
R-HSA-418594 G alpha (i) signalling events
R-HSA-418597 G alpha (z) signalling events

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Regulator of G-protein signaling protein-like
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RGSL1
Synonyms:RGSL, RGSL2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000121446.18

Human Gene Nomenclature Database

More...
HGNCi
HGNC:18636 RGSL1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
611012 gene
611013 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_A5PLK6

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei960 – 982HelicalSequence analysisAdd BLAST23

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
353299

Open Targets

More...
OpenTargetsi
ENSG00000121446

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134870196

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
RGSL1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003493051 – 1076Regulator of G-protein signaling protein-likeAdd BLAST1076

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
A5PLK6

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
A5PLK6

PRoteomics IDEntifications database

More...
PRIDEi
A5PLK6

ProteomicsDB human proteome resource

More...
ProteomicsDBi
731
732 [A5PLK6-2]
733 [A5PLK6-3]
734 [A5PLK6-4]
735 [A5PLK6-5]
736 [A5PLK6-6]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
A5PLK6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
A5PLK6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000121446 Expressed in 48 organ(s), highest expression level in right testis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
A5PLK6 baseline and differential

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
131681, 2 interactors

Protein interaction database and analysis system

More...
IntActi
A5PLK6, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000457748

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
A5PLK6

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
A5PLK6

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini645 – 764RGSAdd BLAST120

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi1044 – 1047Poly-Ser4

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IVN7 Eukaryota
ENOG4111P2K LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00660000095605

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG108405

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
A5PLK6

Identification of Orthologs from Complete Genome Data

More...
OMAi
ANMEEME

Database of Orthologous Groups

More...
OrthoDBi
204702at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
A5PLK6

TreeFam database of animal gene trees

More...
TreeFami
TF336510

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR016137 RGS
IPR036305 RGS_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00615 RGS, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48097 SSF48097, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 13 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: A5PLK6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSSAEIIGST NLIILLEDEV FADFFNTFLS LPVFGQTPFY TVENSQWSLW
60 70 80 90 100
PEIPCNLIAK YKGLLTWLEK CRLPFFCKTN LCFHYILCQE FISFIKSPEG
110 120 130 140 150
GEELVDFWIL AENILSIDEM DLEVRDYYLS LLLMLRATHL QEGSRVVTLC
160 170 180 190 200
NMNIKSLLNL SIWHPNQSTT RREILSHMQK VALFKLQSYW LPNFYTHTKM
210 220 230 240 250
TMAKEEACHG LMQEYETRLY SVCYTHIGGL PLNMSIKKCH HFQKRYSSRK
260 270 280 290 300
AKRKMWQLVD PDSWSLEMDL KPDAIGMPLQ ETCPQEKVVI QMPSLKMASS
310 320 330 340 350
KETRISSLEK DMHYAKISSM ENKAKSHLHM EAPFETKVST HLRTVIPIVN
360 370 380 390 400
HSSKMTIQKA IKQSFSLGYI HLALCADACA GNPFRDHLKK LNLKVEIQLL
410 420 430 440 450
DLWQDLQHFL SVLLNNKKNG NAIFRHLLGD RICELYLNEQ IGPCLPLKSQ
460 470 480 490 500
TIQGLKELLP SGDVIPWIPK AQKEICKMLS PWYDEFLDEE DYWFLLFTTQ
510 520 530 540 550
NRFISSRQHK REFIGKEENI LLYKRIQQSL ELSQALADMK EMDYRQWRKI
560 570 580 590 600
ATEDLKQGGS LQVELTSPVF LTDITKMSFE ELCYKNPKMA IQKISDDYKI
610 620 630 640 650
YCEKAPKIDF KMEIIKETKT VSRSNRKMSL LKRTLVRKPS MRPRNLTEVL
660 670 680 690 700
LNTQHLEFFR EFLKERKAKI PLQFLTAVQK ISIETNEKIC KSLIENVIKT
710 720 730 740 750
FFQGQLSPEE MLQCDAPIIK EIASMRHVTT STLLTLQGHV MKSIEEKWFK
760 770 780 790 800
DYQDLFPPHH QEVEVQSEVQ ISSRKPSKIV STYLQESQKK GWMRMISFIR
810 820 830 840 850
SFCKYRRFML NPSKRQEFED YLHQEMQNSK ENFTTAHNTS GRSAPPSTNV
860 870 880 890 900
RSADQENGEI TLVKRRIFGH RIITVNFAIN DLYFFSEMEK FNDLVSSAHM
910 920 930 940 950
LQVNRAYNEN DVILMRSKMN IIQKLFLNSD IPPKLRVNVP EFQKDAILAA
960 970 980 990 1000
ITEGYLDRSV FHGAIMSVFP VVMYFWKRFC FWKATRSYLQ YRGKKFKDRK
1010 1020 1030 1040 1050
SPPKSTDKYP FSSGGDNAIL RFTLLRGIEW LQPQREAISS VQNSSSSKLT
1060 1070
QPRLVVSAMQ LHPVQGQKLS YIKKEK
Note: No experimental confirmation available.
Length:1,076
Mass (Da):125,688
Last modified:July 10, 2007 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7B398FB2DAA2C7E7
GO
Isoform 2 (identifier: A5PLK6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-477: Missing.

Note: No experimental confirmation available.
Show »
Length:599
Mass (Da):70,585
Checksum:iC33828386783ACAF
GO
Isoform 3 (identifier: A5PLK6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-576: Missing.

Show »
Length:500
Mass (Da):58,632
Checksum:iA319D30E28B5DFD8
GO
Isoform 4 (identifier: A5PLK6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-576: Missing.
     979-1076: Missing.

Show »
Length:402
Mass (Da):47,326
Checksum:i0F53417E39786501
GO
Isoform 5 (identifier: A5PLK6-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-477: Missing.
     938-949: NVPEFQKDAILA → LFLEGNPLLLTV
     950-1076: Missing.

Note: No experimental confirmation available.
Show »
Length:472
Mass (Da):55,860
Checksum:iF14AA083F5659847
GO
Isoform 6 (identifier: A5PLK6-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     100-100: G → GAKMMRWKKADQWLLQKCIGGVRGMWRFYSYLTGSA
     499-504: TQNRFI → VGRTLG
     505-1076: Missing.

Show »
Length:539
Mass (Da):62,597
Checksum:iECA07C75D6FA7035
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 13 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H3BU64H3BU64_HUMAN
Regulator of G-protein-signaling pr...
RGSL1
984Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BRN5H3BRN5_HUMAN
Regulator of G-protein-signaling pr...
RGSL1
154Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BVE8H3BVE8_HUMAN
Regulator of G-protein-signaling pr...
RGSL1
160Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BNQ0H3BNQ0_HUMAN
Regulator of G-protein-signaling pr...
RGSL1
29Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BNR3H3BNR3_HUMAN
Regulator of G-protein-signaling pr...
RGSL1
64Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BNS3H3BNS3_HUMAN
Regulator of G-protein-signaling pr...
RGSL1
29Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3B3ISC9A0A3B3ISC9_HUMAN
Regulator of G-protein-signaling pr...
RGSL1
270Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0U1RQD8A0A0U1RQD8_HUMAN
Regulator of G-protein-signaling pr...
RGSL1
81Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0U1RRF6A0A0U1RRF6_HUMAN
Regulator of G-protein-signaling pr...
RGSL1
166Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0U1RRF3A0A0U1RRF3_HUMAN
Regulator of G-protein-signaling pr...
RGSL1
31Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti683I → V in BC121032 (PubMed:15489334).Curated1
Sequence conflicti683I → V in BC121033 (PubMed:15489334).Curated1
Sequence conflicti823H → L in BC121032 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0463565E → D. Corresponds to variant dbSNP:rs12083859Ensembl.1
Natural variantiVAR_046357256W → C. Corresponds to variant dbSNP:rs647224Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0353471 – 576Missing in isoform 3 and isoform 4. 2 PublicationsAdd BLAST576
Alternative sequenceiVSP_0353481 – 477Missing in isoform 2 and isoform 5. 1 PublicationAdd BLAST477
Alternative sequenceiVSP_035349100G → GAKMMRWKKADQWLLQKCIG GVRGMWRFYSYLTGSA in isoform 6. 1 Publication1
Alternative sequenceiVSP_035350499 – 504TQNRFI → VGRTLG in isoform 6. 1 Publication6
Alternative sequenceiVSP_035351505 – 1076Missing in isoform 6. 1 PublicationAdd BLAST572
Alternative sequenceiVSP_035352938 – 949NVPEF…DAILA → LFLEGNPLLLTV in isoform 5. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_035353950 – 1076Missing in isoform 5. 1 PublicationAdd BLAST127
Alternative sequenceiVSP_035354979 – 1076Missing in isoform 4. 1 PublicationAdd BLAST98

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF510428 mRNA Translation: AAP30864.1
AL136902 mRNA Translation: CAB66836.1
AK128152 mRNA Translation: BAC87300.1
AL138776 Genomic DNA No translation available.
AL139344 Genomic DNA No translation available.
CH471067 Genomic DNA Translation: EAW91125.1
BC121032 mRNA No translation available.
BC121033 mRNA No translation available.
BC142944 mRNA Translation: AAI42945.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS58049.1 [A5PLK6-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001131141.1, NM_001137669.1 [A5PLK6-1]
XP_016856684.1, XM_017001195.1
XP_016856685.1, XM_017001196.1 [A5PLK6-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.121200

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000294854; ENSP00000457748; ENSG00000121446 [A5PLK6-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
353299

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:353299

UCSC genome browser

More...
UCSCi
uc009wxw.5 human [A5PLK6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF510428 mRNA Translation: AAP30864.1
AL136902 mRNA Translation: CAB66836.1
AK128152 mRNA Translation: BAC87300.1
AL138776 Genomic DNA No translation available.
AL139344 Genomic DNA No translation available.
CH471067 Genomic DNA Translation: EAW91125.1
BC121032 mRNA No translation available.
BC121033 mRNA No translation available.
BC142944 mRNA Translation: AAI42945.1
CCDSiCCDS58049.1 [A5PLK6-1]
RefSeqiNP_001131141.1, NM_001137669.1 [A5PLK6-1]
XP_016856684.1, XM_017001195.1
XP_016856685.1, XM_017001196.1 [A5PLK6-2]
UniGeneiHs.121200

3D structure databases

ProteinModelPortaliA5PLK6
SMRiA5PLK6
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi131681, 2 interactors
IntActiA5PLK6, 1 interactor
STRINGi9606.ENSP00000457748

PTM databases

iPTMnetiA5PLK6
PhosphoSitePlusiA5PLK6

Polymorphism and mutation databases

BioMutaiRGSL1

Proteomic databases

EPDiA5PLK6
PaxDbiA5PLK6
PRIDEiA5PLK6
ProteomicsDBi731
732 [A5PLK6-2]
733 [A5PLK6-3]
734 [A5PLK6-4]
735 [A5PLK6-5]
736 [A5PLK6-6]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000294854; ENSP00000457748; ENSG00000121446 [A5PLK6-1]
GeneIDi353299
KEGGihsa:353299
UCSCiuc009wxw.5 human [A5PLK6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
353299
DisGeNETi353299
EuPathDBiHostDB:ENSG00000121446.18

GeneCards: human genes, protein and diseases

More...
GeneCardsi
RGSL1
HGNCiHGNC:18636 RGSL1
MIMi611012 gene
611013 gene
neXtProtiNX_A5PLK6
OpenTargetsiENSG00000121446
PharmGKBiPA134870196

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IVN7 Eukaryota
ENOG4111P2K LUCA
GeneTreeiENSGT00660000095605
HOVERGENiHBG108405
InParanoidiA5PLK6
OMAiANMEEME
OrthoDBi204702at2759
PhylomeDBiA5PLK6
TreeFamiTF336510

Enzyme and pathway databases

ReactomeiR-HSA-416476 G alpha (q) signalling events
R-HSA-418594 G alpha (i) signalling events
R-HSA-418597 G alpha (z) signalling events

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
RGSL1 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
353299

Protein Ontology

More...
PROi
PR:A5PLK6

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000121446 Expressed in 48 organ(s), highest expression level in right testis
ExpressionAtlasiA5PLK6 baseline and differential

Family and domain databases

InterProiView protein in InterPro
IPR016137 RGS
IPR036305 RGS_sf
PfamiView protein in Pfam
PF00615 RGS, 1 hit
SUPFAMiSSF48097 SSF48097, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRGSL_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A5PLK6
Secondary accession number(s): A2A2Z0
, A6PVM2, A6PVM3, Q0VAJ4, Q0VAJ5, Q6ZRL0, Q86UV0, Q9H084
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 2, 2008
Last sequence update: July 10, 2007
Last modified: February 13, 2019
This is version 83 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again