Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 102 (13 Feb 2019)
Sequence version 3 (25 Nov 2008)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

C-type lectin domain family 18 member A

Gene

CLEC18A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Binds polysaccharides in a Ca2+-independent manner with a preferentially binding to fucoidan, beta-glucans and galactans (PubMed:26170455).1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • polysaccharide binding Source: UniProtKB

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandLectin

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
C-type lectin domain family 18 member A
Alternative name(s):
Mannose receptor-like protein 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CLEC18A
Synonyms:MRLP2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000157322.16

Human Gene Nomenclature Database

More...
HGNCi
HGNC:30388 CLEC18A

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
616571 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_A5D8T8

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Endoplasmic reticulum, Endosome, Golgi apparatus, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi421D → N: Has a mild effect on polysaccharides binding. 1 Publication1

Organism-specific databases

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA164717976

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CLEC18A

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 26Sequence analysisAdd BLAST26
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000032431627 – 446C-type lectin domain family 18 member AAdd BLAST420

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi144N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi236 ↔ 249By similarity
Disulfide bondi251 ↔ 260By similarity
Disulfide bondi327 ↔ 432By similarity
Disulfide bondi408 ↔ 424By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

N-glycosylated.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
A5D8T8

PRoteomics IDEntifications database

More...
PRIDEi
A5D8T8

ProteomicsDB human proteome resource

More...
ProteomicsDBi
710
711 [A5D8T8-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
A5D8T8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
A5D8T8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Dectected in all cell lines tested and in peripheral blood cells.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000157322 Expressed in 79 organ(s), highest expression level in adult mammalian kidney

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
A5D8T8 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
A5D8T8 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA048976

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
131512, 11 interactors

Protein interaction database and analysis system

More...
IntActi
A5D8T8, 6 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000288040

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
A5D8T8

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
A5D8T8

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini52 – 182SCPAdd BLAST131
Domaini228 – 261EGF-likePROSITE-ProRule annotationAdd BLAST34
Domaini306 – 433C-type lectinPROSITE-ProRule annotationAdd BLAST128

Keywords - Domaini

EGF-like domain, Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3017 Eukaryota
KOG4297 Eukaryota
COG2340 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00900000141128

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000111780

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
A5D8T8

KEGG Orthology (KO)

More...
KOi
K22682

Database of Orthologous Groups

More...
OrthoDBi
1528782at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
A5D8T8

TreeFam database of animal gene trees

More...
TreeFami
TF350472

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.10.100.10, 1 hit
3.40.33.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001304 C-type_lectin-like
IPR016186 C-type_lectin-like/link_sf
IPR018378 C-type_lectin_CS
IPR014044 CAP_domain
IPR035940 CAP_sf
IPR001283 CRISP-related
IPR016187 CTDL_fold
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom

The PANTHER Classification System

More...
PANTHERi
PTHR10334 PTHR10334, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00188 CAP, 1 hit
PF00059 Lectin_C, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00837 V5TPXLIKE

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00034 CLECT, 1 hit
SM00181 EGF, 2 hits
SM00198 SCP, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF55797 SSF55797, 1 hit
SSF56436 SSF56436, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00615 C_TYPE_LECTIN_1, 1 hit
PS50041 C_TYPE_LECTIN_2, 1 hit
PS00022 EGF_1, 2 hits
PS01186 EGF_2, 2 hits
PS50026 EGF_3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: A5D8T8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLHPETSPGR GHLLAVLLAL LGTAWAEVWP PQLQEQAPMA GALNRKESFL
60 70 80 90 100
LLSLHNRLRS WVQPPAADMR RLDWSDSLAQ LAQARAALCG TPTPSLASGL
110 120 130 140 150
WRTLQVGWNM QLLPAGLVSF VEVVSLWFAE GQRYSHAAGE CARNATCTHY
160 170 180 190 200
TQLVWATSSQ LGCGRHLCSA GQAAIEAFVC AYSPRGNWEV NGKTIVPYKK
210 220 230 240 250
GAWCSLCTAS VSGCFKAWDH AGGLCEVPRN PCRMSCQNHG RLNISTCHCH
260 270 280 290 300
CPPGYTGRYC QVRCSLQCVH GRFREEECSC VCDIGYGGAQ CATKVHFPFH
310 320 330 340 350
TCDLRIDGDC FMVSSEADTY YRARMKCQRK GGVLAQIKSQ KVQDILAFYL
360 370 380 390 400
GRLETTNEVI DSDFETRNFW IGLTYKTAKD SFRWATGEHQ AFTSFAFGQP
410 420 430 440
DNHGFGNCVE LQASAAFNWN DQRCKTRNRY ICQFAQEHIS RWGPGS
Length:446
Mass (Da):49,602
Last modified:November 25, 2008 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC33BD9480D47DB9B
GO
Isoform 2 (identifier: A5D8T8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-340: Missing.
     341-371: KVQDILAFYLGRLETTNEVIDSDFETRNFWI → MGAASAGKRGQKGSWQQTPGSEWANLDYPGP

Show »
Length:106
Mass (Da):11,762
Checksum:iBCF4991E23A9F0B0
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8W692F8W692_HUMAN
C-type lectin domain family 18 memb...
CLEC18A
455Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BNR9H3BNR9_HUMAN
C-type lectin domain family 18 memb...
CLEC18A
66Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH08616 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti273F → L in AAH78143 (PubMed:15489334).Curated1
Sequence conflicti401 – 402DN → AT in AAH08616 (PubMed:15489334).Curated2
Sequence conflicti421D → N in AAH78143 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_059449118V → A in allele CLEC18A-1. 4 PublicationsCorresponds to variant dbSNP:rs2549097Ensembl.1
Natural variantiVAR_074610151T → M in allele CLEC18A-1. 3 PublicationsCorresponds to variant dbSNP:rs75776403Ensembl.1
Natural variantiVAR_074611339S → R in allele CLEC18A-1; abolishes binding to polysaccharides. 2 Publications1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0322041 – 340Missing in isoform 2. 1 PublicationAdd BLAST340
Alternative sequenceiVSP_032205341 – 371KVQDI…RNFWI → MGAASAGKRGQKGSWQQTPG SEWANLDYPGP in isoform 2. 1 PublicationAdd BLAST31

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF521893 mRNA Translation: AAP80866.1
AK289884 mRNA Translation: BAF82573.1
AC026468 Genomic DNA No translation available.
BC008616 mRNA Translation: AAH08616.1 Different initiation.
BC078143 mRNA Translation: AAH78143.1
BC141808 mRNA Translation: AAI41809.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS10886.1 [A5D8T8-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001129686.1, NM_001136214.2 [A5D8T8-1]
NP_001258126.1, NM_001271197.1 [A5D8T8-1]
NP_872425.2, NM_182619.3 [A5D8T8-1]
XP_005255991.1, XM_005255934.1 [A5D8T8-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.592064

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000288040; ENSP00000288040; ENSG00000157322 [A5D8T8-1]
ENST00000393701; ENSP00000377304; ENSG00000157322 [A5D8T8-1]
ENST00000568461; ENSP00000454685; ENSG00000157322 [A5D8T8-1]
ENST00000615430; ENSP00000484176; ENSG00000157322 [A5D8T8-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
348174

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:348174

UCSC genome browser

More...
UCSCi
uc002exz.5 human [A5D8T8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF521893 mRNA Translation: AAP80866.1
AK289884 mRNA Translation: BAF82573.1
AC026468 Genomic DNA No translation available.
BC008616 mRNA Translation: AAH08616.1 Different initiation.
BC078143 mRNA Translation: AAH78143.1
BC141808 mRNA Translation: AAI41809.1
CCDSiCCDS10886.1 [A5D8T8-1]
RefSeqiNP_001129686.1, NM_001136214.2 [A5D8T8-1]
NP_001258126.1, NM_001271197.1 [A5D8T8-1]
NP_872425.2, NM_182619.3 [A5D8T8-1]
XP_005255991.1, XM_005255934.1 [A5D8T8-1]
UniGeneiHs.592064

3D structure databases

ProteinModelPortaliA5D8T8
SMRiA5D8T8
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi131512, 11 interactors
IntActiA5D8T8, 6 interactors
STRINGi9606.ENSP00000288040

PTM databases

iPTMnetiA5D8T8
PhosphoSitePlusiA5D8T8

Polymorphism and mutation databases

BioMutaiCLEC18A

Proteomic databases

PaxDbiA5D8T8
PRIDEiA5D8T8
ProteomicsDBi710
711 [A5D8T8-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
348174
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000288040; ENSP00000288040; ENSG00000157322 [A5D8T8-1]
ENST00000393701; ENSP00000377304; ENSG00000157322 [A5D8T8-1]
ENST00000568461; ENSP00000454685; ENSG00000157322 [A5D8T8-1]
ENST00000615430; ENSP00000484176; ENSG00000157322 [A5D8T8-1]
GeneIDi348174
KEGGihsa:348174
UCSCiuc002exz.5 human [A5D8T8-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
348174
EuPathDBiHostDB:ENSG00000157322.16

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CLEC18A
HGNCiHGNC:30388 CLEC18A
HPAiHPA048976
MIMi616571 gene
neXtProtiNX_A5D8T8
PharmGKBiPA164717976

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3017 Eukaryota
KOG4297 Eukaryota
COG2340 LUCA
GeneTreeiENSGT00900000141128
HOGENOMiHOG000111780
InParanoidiA5D8T8
KOiK22682
OrthoDBi1528782at2759
PhylomeDBiA5D8T8
TreeFamiTF350472

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CLEC18A human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
348174

Protein Ontology

More...
PROi
PR:A5D8T8

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000157322 Expressed in 79 organ(s), highest expression level in adult mammalian kidney
ExpressionAtlasiA5D8T8 baseline and differential
GenevisibleiA5D8T8 HS

Family and domain databases

Gene3Di3.10.100.10, 1 hit
3.40.33.10, 1 hit
InterProiView protein in InterPro
IPR001304 C-type_lectin-like
IPR016186 C-type_lectin-like/link_sf
IPR018378 C-type_lectin_CS
IPR014044 CAP_domain
IPR035940 CAP_sf
IPR001283 CRISP-related
IPR016187 CTDL_fold
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
PANTHERiPTHR10334 PTHR10334, 1 hit
PfamiView protein in Pfam
PF00188 CAP, 1 hit
PF00059 Lectin_C, 1 hit
PRINTSiPR00837 V5TPXLIKE
SMARTiView protein in SMART
SM00034 CLECT, 1 hit
SM00181 EGF, 2 hits
SM00198 SCP, 1 hit
SUPFAMiSSF55797 SSF55797, 1 hit
SSF56436 SSF56436, 1 hit
PROSITEiView protein in PROSITE
PS00615 C_TYPE_LECTIN_1, 1 hit
PS50041 C_TYPE_LECTIN_2, 1 hit
PS00022 EGF_1, 2 hits
PS01186 EGF_2, 2 hits
PS50026 EGF_3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCL18A_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A5D8T8
Secondary accession number(s): A8K1G9
, Q6DCB3, Q7Z5K9, Q96HH2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: November 25, 2008
Last modified: February 13, 2019
This is version 102 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again