Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Xin actin-binding repeat-containing protein 2

Gene

XIRP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Protects actin filaments from depolymerization.1 Publication

Miscellaneous

'Xin' means 'heart' in Chinese.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • actin filament binding Source: UniProtKB
  • alpha-actinin binding Source: Ensembl

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActin-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Xin actin-binding repeat-containing protein 2
Alternative name(s):
Beta-xin
Cardiomyopathy-associated protein 3
Xeplin
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:XIRP2
Synonyms:CMYA3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000163092.19

Human Gene Nomenclature Database

More...
HGNCi
HGNC:14303 XIRP2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
609778 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_A4UGR9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell junction

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
129446

Open Targets

More...
OpenTargetsi
ENSG00000163092

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162409337

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
XIRP2

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003169871 – 3374Xin actin-binding repeat-containing protein 2Add BLAST3374

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei621PhosphoserineBy similarity1
Modified residuei868PhosphoserineBy similarity1
Modified residuei1265PhosphoserineBy similarity1
Modified residuei1629PhosphoserineBy similarity1
Modified residuei1989PhosphothreonineBy similarity1
Modified residuei1994PhosphoserineBy similarity1
Modified residuei2222PhosphoserineBy similarity1
Modified residuei2276PhosphoserineBy similarity1
Modified residuei2318PhosphoserineBy similarity1
Modified residuei3059PhosphoserineBy similarity1
Modified residuei3297PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
A4UGR9

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
A4UGR9

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
A4UGR9

PRoteomics IDEntifications database

More...
PRIDEi
A4UGR9

ProteomicsDB human proteome resource

More...
ProteomicsDBi
697
698 [A4UGR9-2]
699 [A4UGR9-3]
700 [A4UGR9-4]
701 [A4UGR9-5]
702 [A4UGR9-6]
703 [A4UGR9-7]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
A4UGR9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
A4UGR9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000163092 Expressed in 100 organ(s), highest expression level in myocardium

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
A4UGR9 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
A4UGR9 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA034813
HPA074599

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with ACTN2 (By similarity). Interacts with F-actin.By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
126192, 6 interactors

Protein interaction database and analysis system

More...
IntActi
A4UGR9, 3 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000295237

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4F14X-ray1.20B2245-2257[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
A4UGR9

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
A4UGR9

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati362 – 377Xin 1Add BLAST16
Repeati397 – 412Xin 2Add BLAST16
Repeati437 – 452Xin 3Add BLAST16
Repeati474 – 489Xin 4Add BLAST16
Repeati512 – 527Xin 5Add BLAST16
Repeati552 – 567Xin 6Add BLAST16
Repeati590 – 605Xin 7Add BLAST16
Repeati628 – 643Xin 8Add BLAST16
Repeati661 – 676Xin 9Add BLAST16
Repeati695 – 710Xin 10Add BLAST16
Repeati732 – 747Xin 11Add BLAST16
Repeati768 – 783Xin 12Add BLAST16
Repeati799 – 814Xin 13Add BLAST16
Repeati837 – 852Xin 14Add BLAST16
Repeati875 – 890Xin 15Add BLAST16
Repeati914 – 929Xin 16Add BLAST16
Repeati947 – 962Xin 17Add BLAST16
Repeati985 – 1000Xin 18Add BLAST16
Repeati1020 – 1035Xin 19Add BLAST16
Repeati1059 – 1074Xin 20Add BLAST16
Repeati1095 – 1110Xin 21Add BLAST16
Repeati1132 – 1147Xin 22Add BLAST16
Repeati1170 – 1185Xin 23Add BLAST16
Repeati1207 – 1222Xin 24Add BLAST16
Repeati1241 – 1256Xin 25Add BLAST16
Repeati1272 – 1287Xin 26Add BLAST16
Repeati1310 – 1325Xin 27Add BLAST16
Repeati1345 – 1360Xin 28Add BLAST16

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili1736 – 1763Sequence analysisAdd BLAST28
Coiled coili2369 – 2394Sequence analysisAdd BLAST26
Coiled coili2768 – 2792Sequence analysisAdd BLAST25
Coiled coili2823 – 2849Sequence analysisAdd BLAST27

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi278 – 282Poly-Pro5
Compositional biasi1036 – 1041Poly-Ser6
Compositional biasi2113 – 2201Pro-richAdd BLAST89

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Xin repeats bind F-actin.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the Xin family.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IF8Z Eukaryota
ENOG410ZM11 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00530000063779

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG108682

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
A4UGR9

Identification of Orthologs from Complete Genome Data

More...
OMAi
RGDINMT

Database of Orthologous Groups

More...
OrthoDBi
30028at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
A4UGR9

TreeFam database of animal gene trees

More...
TreeFami
TF330745

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR012510 Actin-binding_Xin_repeat
IPR030072 XIRP1/XIRP2
IPR030107 XIRP2

The PANTHER Classification System

More...
PANTHERi
PTHR22591 PTHR22591, 1 hit
PTHR22591:SF1 PTHR22591:SF1, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF08043 Xin, 19 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51389 XIN, 28 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (8+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 8 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 8 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: A4UGR9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSPESGHSRI FEATAGPNKP ESGFAEDSAA RGEGVSDLHE VVSLKERMAR
60 70 80 90 100
YQAAVSRGDC RSFSANMMEE SEMCAVPGGL AKVKKQFEDE ITSSRNTFAQ
110 120 130 140 150
YQYQHQNRSE QEAIHSSQVG TSRSSQEMAR NEQEGSKVQK IDVHGTEMVS
160 170 180 190 200
HLEKHTEEVN QASQFHQYVQ ETVIDTPEDE EIPKVSTKLL KEQFEKSAQE
210 220 230 240 250
KILYSDKEMT TPAKQIKTES EYEETFKPSS VVSTSSTSCV STSQRKETST
260 270 280 290 300
TRYSDHSVTS STLAQINATS SGMTEEFPPP PPDVLQTSVD VTAFSQSPEL
310 320 330 340 350
PSPPRRLPVP KDVYSKQRNL YELNRLYKHI HPELRKNLEK DYISEVSEIV
360 370 380 390 400
SSQMNSGSSV SADVQQARYV FENTNDSSQK DLNSEREYLE WDEILKGEVQ
410 420 430 440 450
SIRWIFENQP LDSINNGSPD EGDISRGIAD QEIIAGGDVK YTTWMFETQP
460 470 480 490 500
IDTLGAYSSD TVENAEKIPE LARGDVCTAR WMFETRPLDS MNKMHQSQEE
510 520 530 540 550
SAVTISKDIT GGDVKTVRYM FETQHLDQLG QLHSVDEVHL LQLRSELKEI
560 570 580 590 600
KGNVKRSIKC FETQPLYVIR DGSGQMLEIK TVHREDVEKG DVRTARWMFE
610 620 630 640 650
TQPLDTINKD ITEIKVVRGI SMEENVKGGV SKAKWLFETQ PLEKIKESEE
660 670 680 690 700
VIIEKEKIIG TDVSRKCWMF ETQPLDILKE VPDADSLQRE EIIGGDVQTT
710 720 730 740 750
KHLFETLPIE ALKDSPDIGK LQKITASEEE KGDVRHQKWI FETQPLEDIR
760 770 780 790 800
KDKKEYTRTV KLEEVDRGDV KNYTHIFESN NLIKFDASHK IEVEGVTRGA
810 820 830 840 850
VELNKSLFET TPLYAIQDPL GKYHQVKTVQ QEEIVRGDVR SCRWLFETRP
860 870 880 890 900
IDQFDESIHK FQIIRGISAQ EIQTGNVKSA KWLFETQPLD SIKYFSDVEE
910 920 930 940 950
TESKTEQTRD IVKGDVKTCK WLFETQPMES LYEKVSLMTS SEEIHKGDVK
960 970 980 990 1000
TCTWLFETQP LDTIKDDSET AVKLQTVKQE EIQGGDVRTA CFLFETENLD
1010 1020 1030 1040 1050
SIQGEEVKEI KPVEMDIQAG DVSSMRYKFE NQSLDSISSS SEEVLKKIKT
1060 1070 1080 1090 1100
LKTEDIQKGN VLNCRWLFEN QPIDKIKESQ EGDECVKTVT DIQGGDVRKG
1110 1120 1130 1140 1150
CFIFETFSLD EIKEESDYIS TKKTITEEVI QGDVKSYRML FETQPLYAIQ
1160 1170 1180 1190 1200
DREGSYHEVT TVKKEEVIHG DVRGTRWLFE TKPLDSINKS ETVYVIKSVT
1210 1220 1230 1240 1250
QEDIQKGDVS SVRYRFETQP LDQISEESHN IMPSIDHIQG GNVKTSRQFF
1260 1270 1280 1290 1300
ESENFDKNNY IRTVSVNEIQ KGNVKTSTWL FETHTMDELR GEGLEYENIK
1310 1320 1330 1340 1350
TVTQEDVQKG DVKQAVWLFE NRTFDSIMEA HKGITKMTKE EIPPSDVKTT
1360 1370 1380 1390 1400
TWLFETTPLH EFNETRVEKI EIIGKSIKET LEDLYSQKVI QAPGIIIEAD
1410 1420 1430 1440 1450
EIGDVRMAKY KLMNQASPEI QKEEIIRADL RNIMVNLLSK RDCTEREILI
1460 1470 1480 1490 1500
SEEEKGNVNL TKTQLLNRST EFHAEKEEIV KGDVQQAIKN LFSEERSVKK
1510 1520 1530 1540 1550
GILIQEDEKG DINMTIYCLL HENDGDTIER EEVIGGDVKR TIHNLLSSTS
1560 1570 1580 1590 1600
NNKISERAKI DASERGNVQF FTTCIEAGAL DYLKQLHTES NETLTAKKQE
1610 1620 1630 1640 1650
GEKEIIGGDV EGTKLLLKKR QSLVERTVSE TDIIPGDVHN TVKVFMTEPQ
1660 1670 1680 1690 1700
STFGKIPKEE IIKGDLTSTL NSLSQAVNQK TVTKTEEIIK GNMLATLKSL
1710 1720 1730 1740 1750
KESSHRWKES KQPDAIPGDI EKAIECLEKA TNTKTEILKK ELLKDDLETS
1760 1770 1780 1790 1800
LRSLKEAQRS FKEVHKEGVI KKDAKAVMAG SSGEQKTDIH QVAVQRNKNS
1810 1820 1830 1840 1850
LLQPKPGPFE PAAKWQGGAD TLSQTMGKSC HGNLVEERTE VNLPKAPKGT
1860 1870 1880 1890 1900
VKIVIDREQN NDALEKSLRR LSNSHHKSNV LESGDKTGVW TDTTGEQHLR
1910 1920 1930 1940 1950
DEYMSRQLTS TVSVKNNLTT KESDRAVREL KKDDVFNSIQ SAGKTVGKQQ
1960 1970 1980 1990 2000
TYELRNDHQK MEGFHIKSPK KTKNIKILTD TQSSKPSPTQ HPVSMPVGGT
2010 2020 2030 2040 2050
YDLSGDFQKQ TLLKQETKYS NKDIKKKNIN LQPMWQLLPV EQDTSNVTEM
2060 2070 2080 2090 2100
KVSEKSHNTF KATNKKRETD VHLKSQDFLM KTNTSTGLKM AMERSLNPIN
2110 2120 2130 2140 2150
FNPENNVKES ECPLPPPSPP PPPPSNASSE IEFPLPPPPP LMMFPEKNGF
2160 2170 2180 2190 2200
LPSLSTEKIK AEFESFPGLP LPPPPVDEKS ERESSSMFLP PPPPPTPSQK
2210 2220 2230 2240 2250
PAHLLSSSAP EKHSGDFMQQ YSQKEASNSQ NSQAKIITGK TGVLPPPTLP
2260 2270 2280 2290 2300
KPKLPKHIKD NKNDFSPKVE LATSLSDMEC KITTSKDQKK VMVMTSSEHT
2310 2320 2330 2340 2350
ETKQNVISKS LDERKQLSID SANCLSHTVP GTSAPRKKQI APLIKSHSFP
2360 2370 2380 2390 2400
ESSGQQNPKP YMRKFKTPLM IAEEKYRQQK EEIEKQKQES SYYNIVKTQS
2410 2420 2430 2440 2450
QNQHITEVEK EMPLQKTNEE VSLSGIDSEC TVVQPSPGSQ SNARILGVCS
2460 2470 2480 2490 2500
DNQLSTTSPE TVAAKRLHHV LAASEDKDKM KKEVLQSSRD IMQSKSACEI
2510 2520 2530 2540 2550
KQSHQECSTQ QTQQKKYLEQ LHLPQSKPIS PNFKVKTIKL PTLDHTLNET
2560 2570 2580 2590 2600
DHSYESHKQQ SEIDVQTFTK KQYLKTKKTE ASTECSHKQS LAERHYQLPK
2610 2620 2630 2640 2650
KEKRVTVQLP TESIQKNQED KLKMVPRKQR EFSGSDRGKL PGSEEKNQGP
2660 2670 2680 2690 2700
SMIGRKEERL ITERKHEHLK NKSAPKVVKQ KVIDAHLDSQ TQNFQQTQIQ
2710 2720 2730 2740 2750
TAESKAEHKK LPQPYNSLQE EKCLEVKGIQ EKQVFSNTKD SKQEITQNKS
2760 2770 2780 2790 2800
FFSSVKESQR DDGKGALNIV EFLRKREELQ QILSRVKQFE AEPNKSGLKT
2810 2820 2830 2840 2850
FQTLLNTIPG WLISEDKREY AVHIAMENNL EKVKEEITHI KTQAEDMLVS
2860 2870 2880 2890 2900
YENIIQTAMM SSKTGKPGNK PTSLDETSSK VSNVHVSNNK NSEQKENKIA
2910 2920 2930 2940 2950
KEKTVQHQVA AHHEATVRSH VKTHQEIKLD DSNIPPPSLK TRPPSPTFIT
2960 2970 2980 2990 3000
IESTARRTEN PTKNELSQSP KKDSYVEPPP RRPMSQKSEI HRANTSPSPP
3010 3020 3030 3040 3050
RSRSEQLVRL KDTTAKLSKG AIPCPAATPV PIVEKRSEII MSPATLRRQI
3060 3070 3080 3090 3100
KIETRGRDSP PTITIPVNIN HAASGSFRES VDAQEEIRKV EKRATYVHKD
3110 3120 3130 3140 3150
GLNSTDHMVP DTESYDAVEI IRKVAVPPRL SEHTQRYEAA NRTVQMAENF
3160 3170 3180 3190 3200
VNDPENEINR WFREFEHGPV SEAKSNRRVY AKGETNHNIQ QESRTFCKEE
3210 3220 3230 3240 3250
FGLTSLGNTS FTDFSCKHPR ELREKIPVKQ PRICSETRSL SEHFSGMDAF
3260 3270 3280 3290 3300
ESQIVESKMK TSSSHSSEAG KSGCDFKHAP PTYEDVIAGH ILDISDSPKE
3310 3320 3330 3340 3350
VRKNFQKTWQ ESGRVFKGLG YATADASATE MRTTFQEESA FISEAAAPRQ
3360 3370
GNMYTLSKDS LSNGVPSGRQ AEFS
Length:3,374
Mass (Da):382,300
Last modified:February 5, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF02A01BD2D621F45
GO
Isoform 2 (identifier: A4UGR9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-47: Missing.

Show »
Length:3,327
Mass (Da):377,347
Checksum:iDAC9F3BDE6D3EDE9
GO
Isoform 3 (identifier: A4UGR9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     3344-3345: EA → GK
     3346-3374: Missing.

Show »
Length:3,345
Mass (Da):379,233
Checksum:iBA1BAC0E92843A1E
GO
Isoform 4 (identifier: A4UGR9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MFPMQKGSLN...KGKETSFDKM
     218-771: TESEYEETFK...LEEVDRGDVK → KLLLQDKEIC...KRNRCYSDTE
     772-3374: Missing.

Show »
Length:938
Mass (Da):106,597
Checksum:i07F5488631088491
GO
Isoform 5 (identifier: A4UGR9-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     218-771: TESEYEETFK...LEEVDRGDVK → KLLLQDKEIC...KRNRCYSDTE
     772-3374: Missing.

Show »
Length:763
Mass (Da):86,782
Checksum:i9C40EB72B01F0750
GO
Isoform 6 (identifier: A4UGR9-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MFPMQKGSLN...KGKETSFDKM
     13-13: A → AVFSTDQAQILRLHLHPKLTKTPKNSLKSSTYIS
     218-771: TESEYEETFK...LEEVDRGDVK → KLLLQDKEIC...KRNRCYSDTE
     772-3374: Missing.

Show »
Length:971
Mass (Da):110,333
Checksum:iD7D81097B20E3582
GO
Isoform 7 (identifier: A4UGR9-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-47: Missing.
     218-771: TESEYEETFK...LEEVDRGDVK → KLLLQDKEIC...KRNRCYSDTE
     772-3374: Missing.

Show »
Length:716
Mass (Da):81,830
Checksum:i88B0CF8F625388C8
GO
Isoform 8 (identifier: A4UGR9-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MFPMQKGSLN...KGKETSFDKM

Note: No experimental confirmation available.
Show »
Length:3,549
Mass (Da):402,115
Checksum:i91C17001D04DCDEC
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MQZ3A0A0A0MQZ3_HUMAN
Xin actin-binding repeat-containing...
XIRP2
963Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH18673 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence AAY24138 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence CAD38624 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence CAD89958 differs from that shown. Contaminating sequence.Curated
The sequence CAD91141 differs from that shown. Contaminating sequence.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti112E → G in AAH18673 (PubMed:15489334).Curated1
Sequence conflicti926Q → L in CAF25193 (PubMed:15454575).Curated1
Sequence conflicti926Q → L in CAD38624 (PubMed:17974005).Curated1
Sequence conflicti1144Q → R in CAF25193 (PubMed:15454575).Curated1
Sequence conflicti1144Q → R in CAD38624 (PubMed:17974005).Curated1
Sequence conflicti2318S → P in CAD91137 (PubMed:17974005).Curated1
Sequence conflicti2522H → P in CAD91146 (PubMed:17974005).Curated1
Sequence conflicti2661I → M in CAD91139 (PubMed:17974005).Curated1
Sequence conflicti2665K → N in CAD89958 (PubMed:17974005).Curated1
Sequence conflicti2713Q → R in CAD89919 (PubMed:17974005).Curated1
Sequence conflicti2967S → A in CAD91141 (PubMed:17974005).Curated1
Sequence conflicti2996S → P in CAD89919 (PubMed:17974005).Curated1
Sequence conflicti3013T → A in CAD91154 (PubMed:17974005).Curated1
Sequence conflicti3079E → G in CAD91137 (PubMed:17974005).Curated1
Sequence conflicti3121I → T in CAD89958 (PubMed:17974005).Curated1
Sequence conflicti3166E → G in CAD91141 (PubMed:17974005).Curated1
Sequence conflicti3259M → V in CAD91139 (PubMed:17974005).Curated1
Sequence conflicti3264S → L in CAD91141 (PubMed:17974005).Curated1
Sequence conflicti3329T → A in CAD91146 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_038449450P → A. Corresponds to variant dbSNP:rs16853305Ensembl.1
Natural variantiVAR_038450457Y → H. Corresponds to variant dbSNP:rs16853306Ensembl.1
Natural variantiVAR_0384511397I → T. Corresponds to variant dbSNP:rs7588159Ensembl.1
Natural variantiVAR_0384521488I → T. Corresponds to variant dbSNP:rs7591107Ensembl.1
Natural variantiVAR_0384531626R → H. Corresponds to variant dbSNP:rs16853309Ensembl.1
Natural variantiVAR_0384541833N → S. Corresponds to variant dbSNP:rs7607246Ensembl.1
Natural variantiVAR_0384552423L → R. Corresponds to variant dbSNP:rs16853326Ensembl.1
Natural variantiVAR_0384562553S → N. Corresponds to variant dbSNP:rs16853328Ensembl.1
Natural variantiVAR_0384572595H → Y. Corresponds to variant dbSNP:rs16853329Ensembl.1
Natural variantiVAR_0384582607V → I. Corresponds to variant dbSNP:rs16853330Ensembl.1
Natural variantiVAR_0384592728G → D. Corresponds to variant dbSNP:rs3749002Ensembl.1
Natural variantiVAR_0764342769I → V1 PublicationCorresponds to variant dbSNP:rs781323589Ensembl.1
Natural variantiVAR_0384602910A → T. Corresponds to variant dbSNP:rs16853331Ensembl.1
Natural variantiVAR_0384612975Y → C. Corresponds to variant dbSNP:rs3749003Ensembl.1
Natural variantiVAR_0384623022I → V. Corresponds to variant dbSNP:rs3749004Ensembl.1
Natural variantiVAR_0384633202G → E. Corresponds to variant dbSNP:rs16853333Ensembl.1
Isoform 4 (identifier: A4UGR9-4)
Natural varianti757R → G. Corresponds to variant dbSNP:rs3749005Ensembl.1
Natural varianti885V → G. Corresponds to variant dbSNP:rs3749006Ensembl.1
Natural varianti905E → Q. Corresponds to variant dbSNP:rs16853344Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0308461 – 47Missing in isoform 2 and isoform 7. 1 PublicationAdd BLAST47
Alternative sequenceiVSP_0357171M → MFPMQKGSLNLLRQKWESCD YQRSECHPRDSHCTIFQPQE SKLLAPEGEVVSAPQSLDPT SLPYSTGEEMWSSKPEEKDS VDKSNNTREYGRPEVLKEDS LSSRRRIERFSIALDELRSV FEAPKSGNKPAEYGGKEVEI ERSLCSPAFKSHPGSQLEDS VKDSDKKGKETSFDKM in isoform 4, isoform 6 and isoform 8. 1 Publication1
Alternative sequenceiVSP_03571813A → AVFSTDQAQILRLHLHPKLT KTPKNSLKSSTYIS in isoform 6. 1 Publication1
Alternative sequenceiVSP_035719218 – 771TESEY…RGDVK → KLLLQDKEICILCQKTVYPM ECLVADKQNFHKSCFRCHHC NSKLSLGNYASLHGQIYCKP HFKQLFKSKGNYDEGFGHKQ HKDRWNCKNQSRSVDFIPNE EPNMCKNIAENTLVPGDRNE HLDAGNSEGQRNDLRKLGER GKLKVIWPPSKEIPKKTLPF EEELKMSKPKWPPEMTTLLS PEFKSESLLEDVRTPENKGQ RQDHFPFLQPYLQSTHVCQK EDVIGIKEMKMPEGRKDEKK EGRKNVQDRPSEAEDTKSNR KSAMDLNDNNNVIVQSAEKE KNEKTNQTNGAEVLQVTNTD DEMMPENHKENLNKNNNNNY VAVSYLNNCRQKTSILEFLD LLPLSSEANDTANEYEIEKL ENTSRISELLGIFESEKTYS RNVLAMALKKQTDRAAAGSP VQPAPKPSLSRGLMVKGGSS IISPDTNLLNIKGSHSKSKN LHFFFSNTVKITAFSKKNEN IFNCDLIDSVDQIKNMPCLD LREFGKDVKPWHVETTEAAR NNENTGFDALSHECTAKPLF PRVEVQSEQLTVEEQIKRNR CYSDTE in isoform 4, isoform 5, isoform 6 and isoform 7. 2 PublicationsAdd BLAST554
Alternative sequenceiVSP_035720772 – 3374Missing in isoform 4, isoform 5, isoform 6 and isoform 7. 2 PublicationsAdd BLAST2603
Alternative sequenceiVSP_0308473344 – 3345EA → GK in isoform 3. 1 Publication2
Alternative sequenceiVSP_0308483346 – 3374Missing in isoform 3. 1 PublicationAdd BLAST29

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY820969 mRNA Translation: AAV87913.1
EF119717 mRNA Translation: ABO69245.1
EF119718 mRNA Translation: ABO69246.1
EF119719 mRNA Translation: ABO69247.1
EF119720 mRNA Translation: ABO69248.1
EF119721 mRNA Translation: ABO69249.1
EF119722 mRNA Translation: ABO69250.1
EF119711 mRNA Translation: ABO69251.1
AK096430 mRNA No translation available.
AK122889 mRNA Translation: BAG53782.1
AC093684 Genomic DNA Translation: AAY24138.1 Different initiation.
AC108494 Genomic DNA No translation available.
AC133782 Genomic DNA No translation available.
AC092601 Genomic DNA No translation available.
CH471058 Genomic DNA Translation: EAX11311.1
BC018673 mRNA Translation: AAH18673.1 Sequence problems.
BC022888 mRNA No translation available.
AJ626901 mRNA Translation: CAF25193.1
AL832331 mRNA Translation: CAD38624.1 Sequence problems.
AL831970 mRNA Translation: CAD89919.1
AL832452 mRNA Translation: CAD89958.1 Sequence problems.
AL832336 mRNA Translation: CAD91137.1
AL831985 mRNA Translation: CAD91139.1
AL833291 mRNA Translation: CAD91141.2 Sequence problems.
AL832011 mRNA Translation: CAD91146.1
AL832360 mRNA Translation: CAD91154.1
AL832382 mRNA Translation: CAD91156.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS42768.1 [A4UGR9-4]
CCDS42769.1 [A4UGR9-8]
CCDS56143.1 [A4UGR9-6]
CCDS56144.1 [A4UGR9-2]
CCDS56145.1 [A4UGR9-7]

NCBI Reference Sequences

More...
RefSeqi
NP_001073278.1, NM_001079810.3 [A4UGR9-4]
NP_001186072.1, NM_001199143.1 [A4UGR9-6]
NP_001186073.1, NM_001199144.1 [A4UGR9-2]
NP_001186074.1, NM_001199145.1 [A4UGR9-7]
NP_689594.4, NM_152381.5 [A4UGR9-8]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.73680

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000409043; ENSP00000386454; ENSG00000163092 [A4UGR9-4]
ENST00000409195; ENSP00000386840; ENSG00000163092 [A4UGR9-8]
ENST00000409273; ENSP00000387255; ENSG00000163092 [A4UGR9-2]
ENST00000409605; ENSP00000386981; ENSG00000163092 [A4UGR9-7]
ENST00000409728; ENSP00000386619; ENSG00000163092 [A4UGR9-6]
ENST00000628543; ENSP00000486198; ENSG00000163092 [A4UGR9-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
129446

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:129446

UCSC genome browser

More...
UCSCi
uc002udx.4 human [A4UGR9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY820969 mRNA Translation: AAV87913.1
EF119717 mRNA Translation: ABO69245.1
EF119718 mRNA Translation: ABO69246.1
EF119719 mRNA Translation: ABO69247.1
EF119720 mRNA Translation: ABO69248.1
EF119721 mRNA Translation: ABO69249.1
EF119722 mRNA Translation: ABO69250.1
EF119711 mRNA Translation: ABO69251.1
AK096430 mRNA No translation available.
AK122889 mRNA Translation: BAG53782.1
AC093684 Genomic DNA Translation: AAY24138.1 Different initiation.
AC108494 Genomic DNA No translation available.
AC133782 Genomic DNA No translation available.
AC092601 Genomic DNA No translation available.
CH471058 Genomic DNA Translation: EAX11311.1
BC018673 mRNA Translation: AAH18673.1 Sequence problems.
BC022888 mRNA No translation available.
AJ626901 mRNA Translation: CAF25193.1
AL832331 mRNA Translation: CAD38624.1 Sequence problems.
AL831970 mRNA Translation: CAD89919.1
AL832452 mRNA Translation: CAD89958.1 Sequence problems.
AL832336 mRNA Translation: CAD91137.1
AL831985 mRNA Translation: CAD91139.1
AL833291 mRNA Translation: CAD91141.2 Sequence problems.
AL832011 mRNA Translation: CAD91146.1
AL832360 mRNA Translation: CAD91154.1
AL832382 mRNA Translation: CAD91156.1
CCDSiCCDS42768.1 [A4UGR9-4]
CCDS42769.1 [A4UGR9-8]
CCDS56143.1 [A4UGR9-6]
CCDS56144.1 [A4UGR9-2]
CCDS56145.1 [A4UGR9-7]
RefSeqiNP_001073278.1, NM_001079810.3 [A4UGR9-4]
NP_001186072.1, NM_001199143.1 [A4UGR9-6]
NP_001186073.1, NM_001199144.1 [A4UGR9-2]
NP_001186074.1, NM_001199145.1 [A4UGR9-7]
NP_689594.4, NM_152381.5 [A4UGR9-8]
UniGeneiHs.73680

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4F14X-ray1.20B2245-2257[»]
ProteinModelPortaliA4UGR9
SMRiA4UGR9
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi126192, 6 interactors
IntActiA4UGR9, 3 interactors
STRINGi9606.ENSP00000295237

PTM databases

iPTMnetiA4UGR9
PhosphoSitePlusiA4UGR9

Polymorphism and mutation databases

BioMutaiXIRP2

Proteomic databases

EPDiA4UGR9
jPOSTiA4UGR9
PaxDbiA4UGR9
PRIDEiA4UGR9
ProteomicsDBi697
698 [A4UGR9-2]
699 [A4UGR9-3]
700 [A4UGR9-4]
701 [A4UGR9-5]
702 [A4UGR9-6]
703 [A4UGR9-7]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000409043; ENSP00000386454; ENSG00000163092 [A4UGR9-4]
ENST00000409195; ENSP00000386840; ENSG00000163092 [A4UGR9-8]
ENST00000409273; ENSP00000387255; ENSG00000163092 [A4UGR9-2]
ENST00000409605; ENSP00000386981; ENSG00000163092 [A4UGR9-7]
ENST00000409728; ENSP00000386619; ENSG00000163092 [A4UGR9-6]
ENST00000628543; ENSP00000486198; ENSG00000163092 [A4UGR9-1]
GeneIDi129446
KEGGihsa:129446
UCSCiuc002udx.4 human [A4UGR9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
129446
DisGeNETi129446
EuPathDBiHostDB:ENSG00000163092.19

GeneCards: human genes, protein and diseases

More...
GeneCardsi
XIRP2

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0161911
HGNCiHGNC:14303 XIRP2
HPAiHPA034813
HPA074599
MIMi609778 gene
neXtProtiNX_A4UGR9
OpenTargetsiENSG00000163092
PharmGKBiPA162409337

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IF8Z Eukaryota
ENOG410ZM11 LUCA
GeneTreeiENSGT00530000063779
HOVERGENiHBG108682
InParanoidiA4UGR9
OMAiRGDINMT
OrthoDBi30028at2759
PhylomeDBiA4UGR9
TreeFamiTF330745

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
XIRP2 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
XIRP2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
129446

Protein Ontology

More...
PROi
PR:A4UGR9

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000163092 Expressed in 100 organ(s), highest expression level in myocardium
ExpressionAtlasiA4UGR9 baseline and differential
GenevisibleiA4UGR9 HS

Family and domain databases

InterProiView protein in InterPro
IPR012510 Actin-binding_Xin_repeat
IPR030072 XIRP1/XIRP2
IPR030107 XIRP2
PANTHERiPTHR22591 PTHR22591, 1 hit
PTHR22591:SF1 PTHR22591:SF1, 1 hit
PfamiView protein in Pfam
PF08043 Xin, 19 hits
PROSITEiView protein in PROSITE
PS51389 XIN, 28 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiXIRP2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A4UGR9
Secondary accession number(s): A0PJ94
, B2BBS0, B2BBS1, B2BBS4, B3KVH0, J3KNB1, Q53R52, Q5MJ67, Q702N7, Q86T36, Q86T38, Q86T46, Q86T51, Q86T53, Q86T55, Q86T79, Q86TB6, Q8N1M9, Q8N3R5, Q8TBV6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 5, 2008
Last sequence update: February 5, 2008
Last modified: January 16, 2019
This is version 99 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again