Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Butyrophilin subfamily 2 member A2

Gene

Btn2a2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Inhibits the proliferation of CD4 and CD8 T-cells activated by anti-CD3 antibodies, T-cell metabolism and IL2 and IFNG secretion.1 Publication

GO - Biological processi

  • negative regulation of activated T cell proliferation Source: UniProtKB
  • negative regulation of cellular metabolic process Source: UniProtKB
  • negative regulation of cytokine secretion Source: UniProtKB
  • negative regulation of ERK1 and ERK2 cascade Source: MGI
  • negative regulation of G1/S transition of mitotic cell cycle Source: MGI
  • negative regulation of phosphatidylinositol 3-kinase signaling Source: MGI
  • negative regulation of protein kinase B signaling Source: MGI
  • negative regulation of T cell receptor signaling pathway Source: MGI
  • positive regulation of regulatory T cell differentiation Source: MGI

Enzyme and pathway databases

ReactomeiR-MMU-8851680 Butyrophilin (BTN) family interactions

Names & Taxonomyi

Protein namesi
Recommended name:
Butyrophilin subfamily 2 member A2
Gene namesi
Name:Btn2a2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 13

Organism-specific databases

MGIiMGI:3606486 Btn2a2

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini30 – 244ExtracellularSequence analysisAdd BLAST215
Transmembranei245 – 265HelicalSequence analysisAdd BLAST21
Topological domaini266 – 514CytoplasmicSequence analysisAdd BLAST249

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 29Sequence analysisAdd BLAST29
ChainiPRO_000036705430 – 514Butyrophilin subfamily 2 member A2Add BLAST485

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi47N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi52 ↔ 126PROSITE-ProRule annotation
Glycosylationi115N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi166 ↔ 220PROSITE-ProRule annotation

Post-translational modificationi

N-glycosylated.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiA4QPC6
PRIDEiA4QPC6

PTM databases

iPTMnetiA4QPC6
PhosphoSitePlusiA4QPC6

Expressioni

Tissue specificityi

Widely expressed (at protein level). In the thymus, restricted to the corticomedullary junction, but not confined solely to epithelial cells (at protein level). Significant expression on naive B-cells, splenic natural killer cells, dendritic cells and peritoneal macrophages (at protein level). Negligible expression on naive T-cells up-regulated on activated T-cells (at protein level).1 Publication

Gene expression databases

BgeeiENSMUSG00000053216
ExpressionAtlasiA4QPC6 baseline and differential

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000106062

Structurei

3D structure databases

ProteinModelPortaliA4QPC6
SMRiA4QPC6
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini30 – 142Ig-like V-typeAdd BLAST113
Domaini150 – 232Ig-like C2-typeAdd BLAST83
Domaini295 – 488B30.2/SPRYPROSITE-ProRule annotationAdd BLAST194

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili281 – 304Sequence analysisAdd BLAST24

Sequence similaritiesi

Keywords - Domaini

Coiled coil, Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IJI4 Eukaryota
ENOG410YA6W LUCA
GeneTreeiENSGT00760000118933
HOGENOMiHOG000230860
HOVERGENiHBG050747
InParanoidiA4QPC6
KOiK06712
OMAiFICPAFT
OrthoDBiEOG091G07OP
TreeFamiTF331083

Family and domain databases

CDDicd15819 SPRY_PRY_BTN1_2, 1 hit
Gene3Di2.60.40.10, 2 hits
InterProiView protein in InterPro
IPR001870 B30.2/SPRY
IPR003879 Butyrophylin_SPRY
IPR013320 ConA-like_dom_sf
IPR007110 Ig-like_dom
IPR036179 Ig-like_dom_sf
IPR013783 Ig-like_fold
IPR003599 Ig_sub
IPR013106 Ig_V-set
IPR006574 PRY
IPR037958 SPRY/PRY_BTN1/2
IPR003877 SPRY_dom
PfamiView protein in Pfam
PF13765 PRY, 1 hit
PF00622 SPRY, 1 hit
PF07686 V-set, 1 hit
PRINTSiPR01407 BUTYPHLNCDUF
SMARTiView protein in SMART
SM00409 IG, 1 hit
SM00406 IGv, 1 hit
SM00589 PRY, 1 hit
SM00449 SPRY, 1 hit
SUPFAMiSSF48726 SSF48726, 2 hits
SSF49899 SSF49899, 1 hit
PROSITEiView protein in PROSITE
PS50188 B302_SPRY, 1 hit
PS50835 IG_LIKE, 2 hits

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: A4QPC6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEPTTSLRSC PIASLLFFLV LSLFVLVSAQ FTVIGPAEPI LAMVGENTTL
60 70 80 90 100
HCHLSPERNA EEMEVRWFRW RFFPAVLVYR GHQERPEEQM VAYRGRTTFM
110 120 130 140 150
RTDISKGRVA LIIHNVTAYD NGIYCCYFQE GRSYDQATMK LMVASLGSEP
160 170 180 190 200
LIKMKTLEDG SILLECTSEG WYPEPRAVWR DPYDEVVPAL EEEYTADREG
210 220 230 240 250
LFTVTMTIII RDCSVRNMTC SVNNTLLSQE VESVILIPES FVPSLPLWMV
260 270 280 290 300
AVAVTLPVVM LILLTSGSIC LVKKHRRKKS ILSAEKEAEY EEKEAARQLQ
310 320 330 340 350
EELRWRRTLL HAADVVLDPD TAHPELFLSD DQRSVIRGSS RQSVPDNPER
360 370 380 390 400
FDCRPCVLGR ESFSSGKHYW EVEVENVMVW AIGVCRDSVE RKGEALLVPQ
410 420 430 440 450
NGFWTLEMFG SQYRALSSPE KIIPLKERLH RIAVFLDCEG GDISFYNMRD
460 470 480 490 500
RSHIYTCPPV TFTGPLRPFF RLGSDDSPLF ICPAFTGAQG VTIPEGGLFL
510
YKTRPISQSL VRKP
Length:514
Mass (Da):58,455
Last modified:February 5, 2008 - v1
Checksum:i2C988E1520BE11F1
GO
Isoform 2 (identifier: A4QPC6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     372-400: Missing.
     422-451: IIPLKERLHRIAVFLDCEGGDISFYNMRDR → DHTSERASSPYSCLPGL

Note: No experimental confirmation available.
Show »
Length:472
Mass (Da):53,488
Checksum:iD787E148EE5E5721
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_036621372 – 400Missing in isoform 2. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_036622422 – 451IIPLK…NMRDR → DHTSERASSPYSCLPGL in isoform 2. 1 PublicationAdd BLAST30

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY177686 mRNA Translation: AAO38196.1
BC139760 mRNA Translation: AAI39761.1
CCDSiCCDS36619.1 [A4QPC6-1]
RefSeqiNP_001276544.1, NM_001289615.1 [A4QPC6-1]
NP_787952.2, NM_175938.3 [A4QPC6-1]
XP_006516727.1, XM_006516664.1 [A4QPC6-1]
UniGeneiMm.129668

Genome annotation databases

EnsembliENSMUST00000110432; ENSMUSP00000106062; ENSMUSG00000053216 [A4QPC6-1]
ENSMUST00000110433; ENSMUSP00000106063; ENSMUSG00000053216 [A4QPC6-1]
GeneIDi238555
KEGGimmu:238555
UCSCiuc007ptu.1 mouse [A4QPC6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiBT2A2_MOUSE
AccessioniPrimary (citable) accession number: A4QPC6
Secondary accession number(s): Q811T8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 24, 2009
Last sequence update: February 5, 2008
Last modified: February 28, 2018
This is version 86 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health