Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tubulin monoglycylase TTLL3

Gene

Ttll3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Monoglycylase which modifies alpha- and beta-tubulin, generating side chains of glycine on the gamma-carboxyl groups of specific glutamate residues within the C-terminal tail of alpha- and beta-tubulin. Involved in the side-chain initiation step of the glycylation reaction by adding a single glycine chain to generate monoglycine side chains. Not involved in elongation step of the polyglycylation reaction.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei527ATPBy similarity1
Binding sitei529ATPBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi514 – 517ATP bindingBy similarity4

GO - Molecular functioni

GO - Biological processi

  • axoneme assembly Source: UniProtKB
  • cilium assembly Source: MGI
  • protein polyglycylation Source: UniProtKB

Keywordsi

Molecular functionLigase
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-MMU-8955332 Carboxyterminal post-translational modifications of tubulin

Names & Taxonomyi

Protein namesi
Recommended name:
Tubulin monoglycylase TTLL3 (EC:6.3.2.-)
Alternative name(s):
Tubulin--tyrosine ligase-like protein 3
Gene namesi
Name:Ttll3Imported
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 6

Organism-specific databases

MGIiMGI:2141418 Ttll3

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Cytoskeleton, Microtubule

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003261591 – 927Tubulin monoglycylase TTLL3Add BLAST927

Proteomic databases

PaxDbiA4Q9E5
PRIDEiA4Q9E5

PTM databases

PhosphoSitePlusiA4Q9E5

Expressioni

Tissue specificityi

Widely expressed with highest levels in brain and testis.1 Publication

Gene expression databases

BgeeiENSMUSG00000030276 Expressed in 167 organ(s), highest expression level in rostral migratory stream
CleanExiMM_TTLL3
ExpressionAtlasiA4Q9E5 baseline and differential
GenevisibleiA4Q9E5 MM

Interactioni

Protein-protein interaction databases

IntActiA4Q9E5, 1 interactor
STRINGi10090.ENSMUSP00000032414

Structurei

3D structure databases

ProteinModelPortaliA4Q9E5
SMRiA4Q9E5
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini345 – 702TTLPROSITE-ProRule annotationAdd BLAST358

Phylogenomic databases

eggNOGiKOG2157 Eukaryota
ENOG410XQDM LUCA
GeneTreeiENSGT00760000118951
HOGENOMiHOG000154711
HOVERGENiHBG069401
InParanoidiA4Q9E5
KOiK16608
PhylomeDBiA4Q9E5
TreeFamiTF313087

Family and domain databases

InterProiView protein in InterPro
IPR004344 TTL/TTLL_fam
IPR027753 TTLL3
PANTHERiPTHR12241:SF124 PTHR12241:SF124, 1 hit
PfamiView protein in Pfam
PF03133 TTL, 1 hit
PROSITEiView protein in PROSITE
PS51221 TTL, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 11 Publication (identifier: A4Q9E5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQGVSSALLL SAGQLGPGAA WYRQEGSSEC SWLRRSQPSE LRTNFSSRWP
60 70 80 90 100
WPRNSESRRS ERLQWPGPAS AKPEVASCGD SRRDYSSLPA RHLSSARESS
110 120 130 140 150
MPGALGTVNP QPVRTLVPPT LDEPLPDALR PPDDSLLLWR GLTKGPNHMG
160 170 180 190 200
RLRNAKIHVE RAVKQKKIFM IHGRYPVIRC LLRQRGWVEK KMVHPPGTAL
210 220 230 240 250
PAPQKDLDSS MLGDSDATED EDEEENEMFR ESQLLDLDGF LEFDDLDGIH
260 270 280 290 300
ALMSRMVRNE TPYLIWTTRR DVLDCRFLSK DQMINHYARA GSFTTKVGLC
310 320 330 340 350
LNLRNLPWFD EADADSFFPR CYRLGAEDDK KAFIEDFWLT AARNVLKLVV
360 370 380 390 400
KLEEKSQSIS IQAREEEAPE DTQPKKQEKK LVTVSSDFVD EALSACQEHL
410 420 430 440 450
SSIAHKDIDK DPNSPLYLSP DDWSQFLQRY YQIVHEGAEL RYLEVQVQRC
460 470 480 490 500
EDILQQLQNV VPQLDMEGDR NIWIVKPGAK SRGRGIMCMN RLDEMLKLVD
510 520 530 540 550
CNPMLMKDGK WIVQKYIERP LLIFGTKFDL RQWFLVTDWN PLTVWFYRDS
560 570 580 590 600
YIRFSTQPFS LKNLDNSVHL CNNSIQRHLE ASCHRHPMLP PDNMWSSQRF
610 620 630 640 650
QAHLQEVDAP KAWSSVIVPG MKAAVIHALQ TSQDNVQCRK ASFELYGADF
660 670 680 690 700
VFGEDFQPWL IEINASPTMA PSTAVTARLC AGVQADTLRV VIDRRLDRSC
710 720 730 740 750
DTGAFELIYK QPAVEVPQYV GIRLLVEGST IKKPVPVGHR RTGVRSSLPH
760 770 780 790 800
LLTQQGSGES KDSGSPTHRS ASRKNARAES LEHTEKPEPA AVASVSGKGK
810 820 830 840 850
KAPFHFPSLH SKAWLPSPRV HRPQGRVLRL QHDQLVGSKA LSTTGKALMT
860 870 880 890 900
LPTAKVLMSF PPHPDLKLAP SMLKPGKVGF ELCCTTWRVV LSGGIGEEGH
910 920
RQRAAPRPSS APGKGLSSTE PCSKTET
Length:927
Mass (Da):104,428
Last modified:May 15, 2007 - v1
Checksum:i9E04C14CABD8B311
GO
Isoform 22 Publications (identifier: A4Q9E5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-148: Missing.
     335-435: EDFWLTAARN...FLQRYYQIVH → GKGTPIPGLA...QSKFLFQHGF
     436-927: Missing.

Show »
Length:287
Mass (Da):32,309
Checksum:iECEAC50CA524BB46
GO
Isoform 31 Publication (identifier: A4Q9E5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-223: Missing.
     224-253: EENEMFRESQLLDLDGFLEFDDLDGIHALM → MDTSSPFYAAGQGEASPPSLPVSISSPSLQ

Note: No experimental confirmation available.Curated
Show »
Length:704
Mass (Da):79,080
Checksum:i3FAD889C1DB5CF7D
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7BX03H7BX03_MOUSE
Tubulin monoglycylase TTLL3
Ttll3
928Annotation score:
F8VQA1F8VQA1_MOUSE
Tubulin monoglycylase TTLL3
Ttll3
721Annotation score:
F6T422F6T422_MOUSE
Tubulin monoglycylase TTLL3
Ttll3
68Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti214D → N in BAC26459 (PubMed:16141072).Curated1
Isoform 22 Publications (identifier: A4Q9E5-2)
Sequence conflicti241P → Q in BAC26459 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0527221 – 223Missing in isoform 3. 1 PublicationAdd BLAST223
Alternative sequenceiVSP_0527241 – 148Missing in isoform 2. 2 PublicationsAdd BLAST148
Alternative sequenceiVSP_052723224 – 253EENEM…IHALM → MDTSSPFYAAGQGEASPPSL PVSISSPSLQ in isoform 3. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_052725335 – 435EDFWL…YQIVH → GKGTPIPGLAPSCCLSHRGK EQASPCGLCNPSPFLLPMGL PFISQPWHSEKPREPGLYPV AGSRGGWVGSVWSLDKLLAG PGSTKGNGSLRQSKFLFQHG F in isoform 2. 2 PublicationsAdd BLAST101
Alternative sequenceiVSP_052726436 – 927Missing in isoform 2. 2 PublicationsAdd BLAST492

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AM690746 mRNA Translation: CAM84323.1
AK029462 mRNA Translation: BAC26459.1
AK080321 mRNA Translation: BAC37878.1
BC021404 mRNA Translation: AAH21404.1
CCDSiCCDS39593.2 [A4Q9E5-1]
CCDS85118.1 [A4Q9E5-2]
RefSeqiNP_001136204.1, NM_001142732.1 [A4Q9E5-2]
NP_598684.4, NM_133923.6 [A4Q9E5-1]
UniGeneiMm.388573

Genome annotation databases

EnsembliENSMUST00000032414; ENSMUSP00000032414; ENSMUSG00000030276 [A4Q9E5-1]
ENSMUST00000204026; ENSMUSP00000145049; ENSMUSG00000030276 [A4Q9E5-2]
GeneIDi101100
KEGGimmu:101100
UCSCiuc009dfu.2 mouse [A4Q9E5-2]
uc009dfv.2 mouse [A4Q9E5-1]
uc009dfw.1 mouse [A4Q9E5-3]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AM690746 mRNA Translation: CAM84323.1
AK029462 mRNA Translation: BAC26459.1
AK080321 mRNA Translation: BAC37878.1
BC021404 mRNA Translation: AAH21404.1
CCDSiCCDS39593.2 [A4Q9E5-1]
CCDS85118.1 [A4Q9E5-2]
RefSeqiNP_001136204.1, NM_001142732.1 [A4Q9E5-2]
NP_598684.4, NM_133923.6 [A4Q9E5-1]
UniGeneiMm.388573

3D structure databases

ProteinModelPortaliA4Q9E5
SMRiA4Q9E5
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiA4Q9E5, 1 interactor
STRINGi10090.ENSMUSP00000032414

PTM databases

PhosphoSitePlusiA4Q9E5

Proteomic databases

PaxDbiA4Q9E5
PRIDEiA4Q9E5

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000032414; ENSMUSP00000032414; ENSMUSG00000030276 [A4Q9E5-1]
ENSMUST00000204026; ENSMUSP00000145049; ENSMUSG00000030276 [A4Q9E5-2]
GeneIDi101100
KEGGimmu:101100
UCSCiuc009dfu.2 mouse [A4Q9E5-2]
uc009dfv.2 mouse [A4Q9E5-1]
uc009dfw.1 mouse [A4Q9E5-3]

Organism-specific databases

CTDi26140
MGIiMGI:2141418 Ttll3

Phylogenomic databases

eggNOGiKOG2157 Eukaryota
ENOG410XQDM LUCA
GeneTreeiENSGT00760000118951
HOGENOMiHOG000154711
HOVERGENiHBG069401
InParanoidiA4Q9E5
KOiK16608
PhylomeDBiA4Q9E5
TreeFamiTF313087

Enzyme and pathway databases

ReactomeiR-MMU-8955332 Carboxyterminal post-translational modifications of tubulin

Miscellaneous databases

ChiTaRSiTtll3 mouse
PROiPR:A4Q9E5
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000030276 Expressed in 167 organ(s), highest expression level in rostral migratory stream
CleanExiMM_TTLL3
ExpressionAtlasiA4Q9E5 baseline and differential
GenevisibleiA4Q9E5 MM

Family and domain databases

InterProiView protein in InterPro
IPR004344 TTL/TTLL_fam
IPR027753 TTLL3
PANTHERiPTHR12241:SF124 PTHR12241:SF124, 1 hit
PfamiView protein in Pfam
PF03133 TTL, 1 hit
PROSITEiView protein in PROSITE
PS51221 TTL, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiTTLL3_MOUSE
AccessioniPrimary (citable) accession number: A4Q9E5
Secondary accession number(s): Q8BV51, Q8C0Y7, Q8VDS2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: May 15, 2007
Last modified: September 12, 2018
This is version 88 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again