Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 72 (31 Jul 2019)
Sequence version 1 (01 May 2007)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Regulator of telomere elongation helicase 1

Gene

RTEL1

Organism
Bos taurus (Bovine)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

ATP-dependent DNA helicase implicated in telomere-length regulation, DNA repair and the maintenance of genomic stability. Acts as an anti-recombinase to counteract toxic recombination and limit crossover during meiosis. Regulates meiotic recombination and crossover homeostasis by physically dissociating strand invasion events and thereby promotes noncrossover repair by meiotic synthesis dependent strand annealing (SDSA) as well as disassembly of D loop recombination intermediates. Also disassembles T loops and prevents telomere fragility by counteracting telomeric G4-DNA structures, which together ensure the dynamics and stability of the telomere.UniRule annotation

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi144Iron-sulfur (4Fe-4S)UniRule annotation1
Metal bindingi162Iron-sulfur (4Fe-4S)UniRule annotation1
Metal bindingi171Iron-sulfur (4Fe-4S)UniRule annotation1
Metal bindingi206Iron-sulfur (4Fe-4S)UniRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi42 – 49ATPUniRule annotation8

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding, Helicase, Hydrolase
Biological processDNA damage, DNA repair
Ligand4Fe-4S, ATP-binding, Iron, Iron-sulfur, Metal-binding, Nucleotide-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Regulator of telomere elongation helicase 1UniRule annotation (EC:3.6.4.12UniRule annotation)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RTEL1UniRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiBos taurus (Bovine)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9913 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaLaurasiatheriaCetartiodactylaRuminantiaPecoraBovidaeBovinaeBos
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000009136 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003706091 – 1216Regulator of telomere elongation helicase 1Add BLAST1216

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
A4K436

PRoteomics IDEntifications database

More...
PRIDEi
A4K436

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in adult testis, liver and ovary.1 Publication

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed from the blastocyst stage.1 Publication

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with TERF1.

Interacts (via PIP-box) with PCNA; the interaction is direct and essential for suppressing telomere fragility.

Interacts with MMS19; the interaction mediates the association of RTEL1 with the cytosolic iron-sulfur protein assembly (CIA) complex.

UniRule annotation

GO - Molecular functioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
9913.ENSBTAP00000051019

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini7 – 295Helicase ATP-bindingUniRule annotationAdd BLAST289

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi150 – 166Nuclear localization signalUniRule annotationAdd BLAST17
Motifi249 – 252DEAH box4
Motifi874 – 880Nuclear localization signalUniRule annotation7
Motifi1172 – 1179PIP-box8

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The PIP-box (PCNA interacting peptide) motif mediates the interaction with PCNA and localization to replication foci.UniRule annotation

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the helicase family. RAD3/XPD subfamily.UniRule annotation

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1132 Eukaryota
COG1199 LUCA

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000007558

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
A4K436

KEGG Orthology (KO)

More...
KOi
K11136

Database of Orthologous Groups

More...
OrthoDBi
186062at2759

Family and domain databases

HAMAP database of protein families

More...
HAMAPi
MF_03065 RTEL1, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR006555 ATP-dep_Helicase_C
IPR010614 DEAD_2
IPR014013 Helic_SF1/SF2_ATP-bd_DinG/Rad3
IPR006554 Helicase-like_DEXD_c2
IPR027417 P-loop_NTPase
IPR013020 Rad3/Chl1-like
IPR030845 RTEL1

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF06733 DEAD_2, 1 hit
PF13307 Helicase_C_2, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00488 DEXDc2, 1 hit
SM00491 HELICc2, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52540 SSF52540, 2 hits

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR00604 rad3, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51193 HELICASE_ATP_BIND_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: A4K436-1) [UniParc]FASTAAdd to basket
Also known as: SV-3

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPKITLKGVT VDFPFQPYKC QEEYMSKVLE CLQEKVNGIL ESPTGTGKTL
60 70 80 90 100
CLLCSTLAWR EHLRDAVSAR RIAERASGEL FPDRTLASWG NAIPEGDVPA
110 120 130 140 150
CYTDIPKIIY ASRTHSQLTQ VISELRNTSY RPRVCVLGSR EQLCIHPEVK
160 170 180 190 200
KQESNHMQVH LCRRKVASRS CHFYNNVEEK SLEQELATPI LDIEDLVRSG
210 220 230 240 250
TKHKLCPYYL SRNLKQQADI IFMPYNYLLD AKSRRAHGID LKGTVVIFDE
260 270 280 290 300
AHNVEKMCEE AASFDLTPHD VASELDVIDR VLEERTKVAQ QAELHPEFSA
310 320 330 340 350
DSARSGLNLE PEDLAKLKMI LLRLEGAIDA VELPGDNSGV TKPGSYIFEL
360 370 380 390 400
FAEAQITFQT KGCILDSLDQ LIQHLAGRAG LFTNTAGLQK LVDIIQIVFS
410 420 430 440 450
VDSAEGDPGP MVGLASQSYK VHIHLDAGHR RTAQRSDVWN TTAARKPGKV
460 470 480 490 500
LSYWCFSPGH SMRELVRQGV RTLILTSGTL APMASFSLEM QIPFPVCLEN
510 520 530 540 550
PHVINQHQIW VGVIPKGPDG AQLSSAFDRR FSDECLSSLG KVLSNISRVV
560 570 580 590 600
PHGLLVFFPS YPVMEKSLEF WRARDFTRKL EVRKPLFVEP RSKGGFSEVM
610 620 630 640 650
EAFYARVAAP ESSGAIFLAV CRGKASEGLD FADVNGRGVI VTGLPYPPRM
660 670 680 690 700
DPRVLLKMQF LDEMKAQSGA GGQFLSGHDW YRQQASRAVN QAIGRVIRHR
710 720 730 740 750
HDYGAVFLCD HRFAHADTRA QLPSWVRPHV KVYDSFGHVI RDVAQFFRVA
760 770 780 790 800
QKTMPEPAPR AAAPSLGEGG GIVSVSVSPG PLPTRKAMSL DVHVPSLRQR
810 820 830 840 850
HTGSPVTKDT EGSLCVEYEQ EPVRAQRRPA GLLAALGHNE QLAEGPGDEA
860 870 880 890 900
LPVEEACGCP TLLGPREKRP AEEQRGRRRK VRLVGSSEVP AASTDTGRAK
910 920 930 940 950
LFMVAVKQAL SQASFDTFTQ ALRDYKSSDD LEALVARLSP LFAEDPKKHS
960 970 980 990 1000
LLQGFYQFVR PHHKQQFEEV CLQLTGQGCS SPHKHGHPQR QGAQLALDSS
1010 1020 1030 1040 1050
GRKESDPKLT VSQGATRQLD PCEQLNQGRP HLASGPFPAG DLNCSLHKGS
1060 1070 1080 1090 1100
RAPGAEKQHP STVSAYLADV RRTLGAAGYS QLLTALTTYK QDDDFEKVVA
1110 1120 1130 1140 1150
VVAALTTEKP EDLPLLQRFG MFVRPHHKQR FRQMCVDLSG PGTQAPGPQE
1160 1170 1180 1190 1200
GGPAMPSDPV CEAPSPGPRK TQSKISSFLR CQACWRQHLQ VSRKCPGCCA
1210
ATRKQTLAQV FWPEPQ
Length:1,216
Mass (Da):134,448
Last modified:May 1, 2007 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iEFBE167EAE46F720
GO
Isoform 2 (identifier: A4K436-2) [UniParc]FASTAAdd to basket
Also known as: SV-2

The sequence of this isoform differs from the canonical sequence as follows:
     1063-1091: Missing.
     1177-1177: S → SFLMQRTAEDTGAPGSPLSFPRGQAQLEWAGVACAGCRAEDVVFFKCPSCD

Show »
Length:1,237
Mass (Da):136,639
Checksum:i920FC5998BD6A055
GO
Isoform 3 (identifier: A4K436-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1177-1177: S → SFLMQRTAEDTGAPGSPLSFPRGQAQLEWAGVACAGCRAEDVVFFKCPSCD

Show »
Length:1,266
Mass (Da):139,752
Checksum:iD2A683C816DFED23
GO
Isoform 4 (identifier: A4K436-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1119-1216: FGMFVRPHHK...LAQVFWPEPQ → CLE

Show »
Length:1,121
Mass (Da):123,949
Checksum:iA4A0CBB00D506FA8
GO
Isoform 5 (identifier: A4K436-5) [UniParc]FASTAAdd to basket
Also known as: SV-1

The sequence of this isoform differs from the canonical sequence as follows:
     1063-1216: VSAYLADVRR...LAQVFWPEPQ → GSACSCGHTTSSASDRCVWT

Show »
Length:1,082
Mass (Da):119,494
Checksum:iF162E84152D202DD
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0369411063 – 1216VSAYL…WPEPQ → GSACSCGHTTSSASDRCVWT in isoform 5. 1 PublicationAdd BLAST154
Alternative sequenceiVSP_0369421063 – 1091Missing in isoform 2. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_0369431119 – 1216FGMFV…WPEPQ → CLE in isoform 4. 1 PublicationAdd BLAST98
Alternative sequenceiVSP_0369441177S → SFLMQRTAEDTGAPGSPLSF PRGQAQLEWAGVACAGCRAE DVVFFKCPSCD in isoform 2 and isoform 3. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
DQ323152 Genomic DNA Translation: ABC54575.1
DQ323153 mRNA Translation: ABC54576.1
DQ420360 mRNA Translation: ABD78306.1
DQ420361 mRNA Translation: ABD78307.1
DQ420362 mRNA Translation: ABD78308.1
DQ420363 mRNA Translation: ABD78309.1

NCBI Reference Sequences

More...
RefSeqi
NP_001091044.1, NM_001097575.1 [A4K436-3]

Genome annotation databases

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
505721

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
bta:505721

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ323152 Genomic DNA Translation: ABC54575.1
DQ323153 mRNA Translation: ABC54576.1
DQ420360 mRNA Translation: ABD78306.1
DQ420361 mRNA Translation: ABD78307.1
DQ420362 mRNA Translation: ABD78308.1
DQ420363 mRNA Translation: ABD78309.1
RefSeqiNP_001091044.1, NM_001097575.1 [A4K436-3]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

STRINGi9913.ENSBTAP00000051019

Proteomic databases

PaxDbiA4K436
PRIDEiA4K436

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi505721
KEGGibta:505721

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
51750

Phylogenomic databases

eggNOGiKOG1132 Eukaryota
COG1199 LUCA
HOGENOMiHOG000007558
InParanoidiA4K436
KOiK11136
OrthoDBi186062at2759

Family and domain databases

HAMAPiMF_03065 RTEL1, 1 hit
InterProiView protein in InterPro
IPR006555 ATP-dep_Helicase_C
IPR010614 DEAD_2
IPR014013 Helic_SF1/SF2_ATP-bd_DinG/Rad3
IPR006554 Helicase-like_DEXD_c2
IPR027417 P-loop_NTPase
IPR013020 Rad3/Chl1-like
IPR030845 RTEL1
PfamiView protein in Pfam
PF06733 DEAD_2, 1 hit
PF13307 Helicase_C_2, 1 hit
SMARTiView protein in SMART
SM00488 DEXDc2, 1 hit
SM00491 HELICc2, 1 hit
SUPFAMiSSF52540 SSF52540, 2 hits
TIGRFAMsiTIGR00604 rad3, 1 hit
PROSITEiView protein in PROSITE
PS51193 HELICASE_ATP_BIND_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRTEL1_BOVIN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A4K436
Secondary accession number(s): A4K3A3
, A4K434, A4K435, A5J092
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 5, 2009
Last sequence update: May 1, 2007
Last modified: July 31, 2019
This is version 72 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again