Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

UPF0561 protein C2orf68 homolog

Gene
N/A
Organism
Bos taurus (Bovine)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
UPF0561 protein C2orf68 homolog
OrganismiBos taurus (Bovine)
Taxonomic identifieri9913 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaLaurasiatheriaCetartiodactylaRuminantiaPecoraBovidaeBovinaeBos
Proteomesi
  • UP000009136 Componenti: Chromosome 11

Organism-specific databases

VGNCiVGNC:52617 C11H2orf68

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003287841 – 166UPF0561 protein C2orf68 homologAdd BLAST166

Proteomic databases

PaxDbiA4IFR8
PRIDEiA4IFR8

Expressioni

Gene expression databases

BgeeiENSBTAG00000018291

Interactioni

Protein-protein interaction databases

STRINGi9913.ENSBTAP00000054929

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi92 – 98Poly-Ser7

Sequence similaritiesi

Belongs to the UPF0561 family.Curated

Phylogenomic databases

eggNOGiENOG410IZ82 Eukaryota
ENOG4111P0A LUCA
GeneTreeiENSGT00390000001901
HOVERGENiHBG096819
InParanoidiA4IFR8
OMAiPGLCCKP
OrthoDBiEOG091G15G9
TreeFamiTF328804

Family and domain databases

InterProiView protein in InterPro
IPR018888 UPF0561
PANTHERiPTHR34256 PTHR34256, 1 hit
PfamiView protein in Pfam
PF10573 UPF0561, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: A4IFR8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEAAPSPGSG LCCKPGGRLD MSHGFVHHIR RNQLARDDYD KKVKQAAKEK
60 70 80 90 100
ARRRHTPAPT RPRKPDLQVY LPRHRDGSTH PSNPDCEESG ESSSSGSSEP
110 120 130 140 150
EPPGHQLFCL EYEADSGDIT SVIVYQDDDP GRVSEEVSAH TPLEPLMREA
160
LKLRIQEEIA KRQSRH
Length:166
Mass (Da):18,555
Last modified:April 8, 2008 - v2
Checksum:i2652563E75611AFD
GO
Isoform 2 (identifier: A4IFR8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     127-166: DDDPGRVSEEVSAHTPLEPLMREALKLRIQEEIAKRQSRH → LFPVVGALPSRSSFQGISQRP

Note: No experimental confirmation available.
Show »
Length:147
Mass (Da):16,160
Checksum:i0CFD617C5FCB39DB
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_032789127 – 166DDDPG…RQSRH → LFPVVGALPSRSSFQGISQR P in isoform 2. 1 PublicationAdd BLAST40

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AAFC03063289 Genomic DNA No translation available.
BC134730 mRNA Translation: AAI34731.1
RefSeqiNP_001077244.1, NM_001083775.1 [A4IFR8-2]
XP_005212860.1, XM_005212803.3 [A4IFR8-1]
UniGeneiBt.22633

Genome annotation databases

EnsembliENSBTAT00000024344; ENSBTAP00000024344; ENSBTAG00000018291 [A4IFR8-2]
ENSBTAT00000064372; ENSBTAP00000054929; ENSBTAG00000018291 [A4IFR8-1]
GeneIDi616899
KEGGibta:616899

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiCB068_BOVIN
AccessioniPrimary (citable) accession number: A4IFR8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 8, 2008
Last sequence update: April 8, 2008
Last modified: April 25, 2018
This is version 54 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Uncharacterized protein families (UPF)
    List of uncharacterized protein family (UPF) entries

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health