Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

SH3 domain-containing protein 21

Gene

SH3D21

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
SH3 domain-containing protein 21
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SH3D21
Synonyms:C1orf113
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000214193.9

Human Gene Nomenclature Database

More...
HGNCi
HGNC:26236 SH3D21

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_A4FU49

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000214193

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142672497

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SH3D21

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003371291 – 640SH3 domain-containing protein 21Add BLAST640

Proteomic databases

MaxQB - The MaxQuant DataBase

More...
MaxQBi
A4FU49

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
A4FU49

PRoteomics IDEntifications database

More...
PRIDEi
A4FU49

ProteomicsDB human proteome resource

More...
ProteomicsDBi
663
664 [A4FU49-3]
665 [A4FU49-4]
666 [A4FU49-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
A4FU49

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
A4FU49

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000214193 Expressed in 169 organ(s), highest expression level in left lobe of thyroid gland

CleanEx database of gene expression profiles

More...
CleanExi
HS_C1orf113

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
A4FU49 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
A4FU49 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA042212
HPA042456
HPA066168

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
A4FU49, 2 interactors

Molecular INTeraction database

More...
MINTi
A4FU49

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000403476

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
A4FU49

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
A4FU49

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini65 – 126SH3PROSITE-ProRule annotationAdd BLAST62

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili572 – 626Sequence analysisAdd BLAST55

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi123 – 126Poly-Pro4

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Domaini

Coiled coil, SH3 domain

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4348 Eukaryota
ENOG410XQBY LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160627

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG107554

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
A4FU49

Identification of Orthologs from Complete Genome Data

More...
OMAi
RSKTQTP

Database of Orthologous Groups

More...
OrthoDBi
1577081at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
A4FU49

TreeFam database of animal gene trees

More...
TreeFami
TF351294

Family and domain databases

Conserved Domains Database

More...
CDDi
cd12142 SH3_D21-like, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR035468 SH3D21_SH3

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07653 SH3_2, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00452 SH3DOMAIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00326 SH3, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50044 SSF50044, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50002 SH3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: A4FU49-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVQSELQLQP RAGGRAEAAS WGDRGNDKGG LGNPDMPSVS PGPQRPPKLS
60 70 80 90 100
SLAYDSPPDY LQTVSHPEVY RVLFDYQPEA PDELALRRGD VVKVLSKTTE
110 120 130 140 150
DKGWWEGECQ GRRGVFPDNF VLPPPPIKKL VPRKVVSRES APIKEPKKLM
160 170 180 190 200
PKTSLPTVKK LATATTGPSK AKTSRTPSRD SQKLTSRDSG PNGGFQSGGS
210 220 230 240 250
YHPGRKRSKT QTPQQRSVSS QEEEHSSPVK APSVKRTPMP DKTATPERPP
260 270 280 290 300
APENAPSSKK IPAPDKVPSP EKTLTLGDKA SIPGNSTSGK IPAPDKVPTP
310 320 330 340 350
EKMVTPEDKA SIPENSIIPE ETLTVDKPST PERVFSVEES PALEAPPMDK
360 370 380 390 400
VPNPKMAPLG DEAPTLEKVL TPELSEEEVS TRDDIQFHHF SSEEALQKVK
410 420 430 440 450
YFVAKEDPSS QEEAHTPEAP PPQPPSSERC LGEMKCTLVR GDSSPRQAEL
460 470 480 490 500
KSGPASRPAL EKPHPHEEAT TLPEEAPSND ERTPEEEAPP NEQRPLREEV
510 520 530 540 550
LPKEGVASKE EVTLKEELPP KEEVAPKEEV PPIERAFAQK TRPIKPPPDS
560 570 580 590 600
QETLALPSLV PQNYTENKNE GVDVTSLRGE VESLRRALEL MEVQLERKLT
610 620 630 640
DIWEELKSEK EQRRRLEVQV MQGTQKSQTP RVIHTQTQTY
Note: No experimental confirmation available. Gene prediction based on EST data and similarity to mouse and macaca fascicularis orthologs.
Length:640
Mass (Da):70,519
Last modified:May 20, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i59992262EE553FA3
GO
Isoform 2 (identifier: A4FU49-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: MVQSELQLQPRAGGRAEAASWGDRGNDKGG → MIKEIEDGWWLGKKNGQLGAFPSNFVELLDSGPPS

Note: No experimental confirmation available.
Show »
Length:645
Mass (Da):71,238
Checksum:iD7FA6E6957E2036C
GO
Isoform 3 (identifier: A4FU49-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-96: MVQSELQLQP...RRGDVVKVLS → MIKEIEDGWW...SVSPGPQRPP
     173-179: TSRTPSR → RKSTAAR
     180-640: Missing.

Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:135
Mass (Da):14,779
Checksum:i4790D889DFD47599
GO
Isoform 4 (identifier: A4FU49-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     191-232: PNGGFQSGGS...EEHSSPVKAP → GRAQQPGKGP...RPQLQEDPGS
     233-640: Missing.

Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:232
Mass (Da):25,313
Checksum:i0DA164A88407EF27
GO
Isoform 5 (identifier: A4FU49-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: MVQSELQLQPRAGGRAEAASWGDRGNDKGG → MEVLVLAGYR...VELLDSGPPS

Show »
Length:756
Mass (Da):83,970
Checksum:i1B6BA2463B701102
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RD64D6RD64_HUMAN
SH3 domain-containing protein 21
SH3D21
135Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAI01677 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS.Curated
The sequence AAI01679 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS.Curated
The sequence BAB15504 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAB71191 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS.Curated
The sequence EAX07375 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence EAX07376 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti327K → E in BAB71191 (PubMed:14702039).Curated1
Sequence conflicti413E → G in BAB71191 (PubMed:14702039).Curated1
Sequence conflicti541 – 542TR → NS in BAB71191 (PubMed:14702039).Curated2
Sequence conflicti582E → G in BAB71191 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_043619217S → A. Corresponds to variant dbSNP:rs12121759Ensembl.1
Natural variantiVAR_056763455A → S. Corresponds to variant dbSNP:rs12121759Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0409231 – 96MVQSE…VKVLS → MIKEIEDGWWLGKRNGQLGA FPSNFVELLDSGPPSLGNPD MPSVSPGPQRPP in isoform 3. 2 PublicationsAdd BLAST96
Alternative sequenceiVSP_0409241 – 30MVQSE…NDKGG → MIKEIEDGWWLGKKNGQLGA FPSNFVELLDSGPPS in isoform 2. 2 PublicationsAdd BLAST30
Alternative sequenceiVSP_0459361 – 30MVQSE…NDKGG → MEVLVLAGYRAQKEDELSLA PGDVVRQVRWVPARGWLRGE FGGRYGLFPERLVQEIPETL RGSGEARRPRCARRRGHPAK HPRPQRWCKVNFSYSPEQAD ELKLQAGEIVEMIKEIEDGW WLGKKNGQLGAFPSNFVELL DSGPPS in isoform 5. CuratedAdd BLAST30
Alternative sequenceiVSP_040925173 – 179TSRTPSR → RKSTAAR in isoform 3. 2 Publications7
Alternative sequenceiVSP_040926180 – 640Missing in isoform 3. 2 PublicationsAdd BLAST461
Alternative sequenceiVSP_040927191 – 232PNGGF…PVKAP → GRAQQPGKGPLCEENPHAGQ DCHPREAPSSRERPQLQEDP GS in isoform 4. 1 PublicationAdd BLAST42
Alternative sequenceiVSP_040928233 – 640Missing in isoform 4. 1 PublicationAdd BLAST408

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK026591 mRNA Translation: BAB15504.1 Different initiation.
AK297015 mRNA Translation: BAG59548.1
AK056459 mRNA Translation: BAB71191.1 Sequence problems.
AL591845 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX07374.1
CH471059 Genomic DNA Translation: EAX07375.1 Sequence problems.
CH471059 Genomic DNA Translation: EAX07376.1 Sequence problems.
BC036763 mRNA Translation: AAH36763.1
BC048273 mRNA Translation: AAH48273.1
BC101676 mRNA Translation: AAI01677.1 Sequence problems.
BC101678 mRNA Translation: AAI01679.1 Sequence problems.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS30674.2 [A4FU49-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001156002.1, NM_001162530.1 [A4FU49-6]
NP_078952.4, NM_024676.4 [A4FU49-3]
XP_016857835.1, XM_017002346.1

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.524496

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000453908; ENSP00000403476; ENSG00000214193 [A4FU49-6]
ENST00000505871; ENSP00000421294; ENSG00000214193 [A4FU49-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
79729

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:79729

UCSC genome browser

More...
UCSCi
uc010oia.2 human [A4FU49-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK026591 mRNA Translation: BAB15504.1 Different initiation.
AK297015 mRNA Translation: BAG59548.1
AK056459 mRNA Translation: BAB71191.1 Sequence problems.
AL591845 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX07374.1
CH471059 Genomic DNA Translation: EAX07375.1 Sequence problems.
CH471059 Genomic DNA Translation: EAX07376.1 Sequence problems.
BC036763 mRNA Translation: AAH36763.1
BC048273 mRNA Translation: AAH48273.1
BC101676 mRNA Translation: AAI01677.1 Sequence problems.
BC101678 mRNA Translation: AAI01679.1 Sequence problems.
CCDSiCCDS30674.2 [A4FU49-3]
RefSeqiNP_001156002.1, NM_001162530.1 [A4FU49-6]
NP_078952.4, NM_024676.4 [A4FU49-3]
XP_016857835.1, XM_017002346.1
UniGeneiHs.524496

3D structure databases

ProteinModelPortaliA4FU49
SMRiA4FU49
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiA4FU49, 2 interactors
MINTiA4FU49
STRINGi9606.ENSP00000403476

PTM databases

iPTMnetiA4FU49
PhosphoSitePlusiA4FU49

Polymorphism and mutation databases

BioMutaiSH3D21

Proteomic databases

MaxQBiA4FU49
PaxDbiA4FU49
PRIDEiA4FU49
ProteomicsDBi663
664 [A4FU49-3]
665 [A4FU49-4]
666 [A4FU49-5]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000453908; ENSP00000403476; ENSG00000214193 [A4FU49-6]
ENST00000505871; ENSP00000421294; ENSG00000214193 [A4FU49-3]
GeneIDi79729
KEGGihsa:79729
UCSCiuc010oia.2 human [A4FU49-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
79729
EuPathDBiHostDB:ENSG00000214193.9

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SH3D21

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0199850
HGNCiHGNC:26236 SH3D21
HPAiHPA042212
HPA042456
HPA066168
neXtProtiNX_A4FU49
OpenTargetsiENSG00000214193
PharmGKBiPA142672497

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4348 Eukaryota
ENOG410XQBY LUCA
GeneTreeiENSGT00940000160627
HOVERGENiHBG107554
InParanoidiA4FU49
OMAiRSKTQTP
OrthoDBi1577081at2759
PhylomeDBiA4FU49
TreeFamiTF351294

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SH3D21 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
79729

Protein Ontology

More...
PROi
PR:A4FU49

Gene expression databases

BgeeiENSG00000214193 Expressed in 169 organ(s), highest expression level in left lobe of thyroid gland
CleanExiHS_C1orf113
ExpressionAtlasiA4FU49 baseline and differential
GenevisibleiA4FU49 HS

Family and domain databases

CDDicd12142 SH3_D21-like, 1 hit
InterProiView protein in InterPro
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR035468 SH3D21_SH3
PfamiView protein in Pfam
PF07653 SH3_2, 1 hit
PRINTSiPR00452 SH3DOMAIN
SMARTiView protein in SMART
SM00326 SH3, 1 hit
SUPFAMiSSF50044 SSF50044, 1 hit
PROSITEiView protein in PROSITE
PS50002 SH3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSH321_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A4FU49
Secondary accession number(s): B4DLI6
, D3DPS6, J3KQM5, Q5VTK7, Q86XZ6, Q8N445, Q96DN4, Q9H5W5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: May 20, 2008
Last modified: January 16, 2019
This is version 100 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again