Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

SH3 domain-containing protein 21

Gene

SH3D21

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
SH3 domain-containing protein 21
Gene namesi
Name:SH3D21
Synonyms:C1orf113
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000214193.9
HGNCiHGNC:26236 SH3D21
neXtProtiNX_A4FU49

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000214193
PharmGKBiPA142672497

Polymorphism and mutation databases

BioMutaiSH3D21

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003371291 – 640SH3 domain-containing protein 21Add BLAST640

Proteomic databases

MaxQBiA4FU49
PaxDbiA4FU49
PRIDEiA4FU49
ProteomicsDBi663
664 [A4FU49-3]
665 [A4FU49-4]
666 [A4FU49-5]

PTM databases

iPTMnetiA4FU49
PhosphoSitePlusiA4FU49

Expressioni

Gene expression databases

BgeeiENSG00000214193 Expressed in 169 organ(s), highest expression level in left lobe of thyroid gland
CleanExiHS_C1orf113
ExpressionAtlasiA4FU49 baseline and differential
GenevisibleiA4FU49 HS

Organism-specific databases

HPAiHPA042212
HPA042456
HPA066168

Interactioni

Protein-protein interaction databases

IntActiA4FU49, 2 interactors
MINTiA4FU49
STRINGi9606.ENSP00000403476

Structurei

3D structure databases

ProteinModelPortaliA4FU49
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini65 – 126SH3PROSITE-ProRule annotationAdd BLAST62

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili572 – 626Sequence analysisAdd BLAST55

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi123 – 126Poly-Pro4

Keywords - Domaini

Coiled coil, SH3 domain

Phylogenomic databases

eggNOGiKOG4348 Eukaryota
ENOG410XQBY LUCA
GeneTreeiENSGT00530000063594
HOVERGENiHBG107554
InParanoidiA4FU49
OMAiRSKTQTP
OrthoDBiEOG091G08QF
PhylomeDBiA4FU49
TreeFamiTF351294

Family and domain databases

CDDicd12142 SH3_D21-like, 1 hit
InterProiView protein in InterPro
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR035468 SH3D21_SH3
PfamiView protein in Pfam
PF07653 SH3_2, 1 hit
PRINTSiPR00452 SH3DOMAIN
SMARTiView protein in SMART
SM00326 SH3, 1 hit
SUPFAMiSSF50044 SSF50044, 1 hit
PROSITEiView protein in PROSITE
PS50002 SH3, 1 hit

Sequences (5+)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: A4FU49-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVQSELQLQP RAGGRAEAAS WGDRGNDKGG LGNPDMPSVS PGPQRPPKLS
60 70 80 90 100
SLAYDSPPDY LQTVSHPEVY RVLFDYQPEA PDELALRRGD VVKVLSKTTE
110 120 130 140 150
DKGWWEGECQ GRRGVFPDNF VLPPPPIKKL VPRKVVSRES APIKEPKKLM
160 170 180 190 200
PKTSLPTVKK LATATTGPSK AKTSRTPSRD SQKLTSRDSG PNGGFQSGGS
210 220 230 240 250
YHPGRKRSKT QTPQQRSVSS QEEEHSSPVK APSVKRTPMP DKTATPERPP
260 270 280 290 300
APENAPSSKK IPAPDKVPSP EKTLTLGDKA SIPGNSTSGK IPAPDKVPTP
310 320 330 340 350
EKMVTPEDKA SIPENSIIPE ETLTVDKPST PERVFSVEES PALEAPPMDK
360 370 380 390 400
VPNPKMAPLG DEAPTLEKVL TPELSEEEVS TRDDIQFHHF SSEEALQKVK
410 420 430 440 450
YFVAKEDPSS QEEAHTPEAP PPQPPSSERC LGEMKCTLVR GDSSPRQAEL
460 470 480 490 500
KSGPASRPAL EKPHPHEEAT TLPEEAPSND ERTPEEEAPP NEQRPLREEV
510 520 530 540 550
LPKEGVASKE EVTLKEELPP KEEVAPKEEV PPIERAFAQK TRPIKPPPDS
560 570 580 590 600
QETLALPSLV PQNYTENKNE GVDVTSLRGE VESLRRALEL MEVQLERKLT
610 620 630 640
DIWEELKSEK EQRRRLEVQV MQGTQKSQTP RVIHTQTQTY
Note: No experimental confirmation available. Gene prediction based on EST data and similarity to mouse and macaca fascicularis orthologs.
Length:640
Mass (Da):70,519
Last modified:May 20, 2008 - v2
Checksum:i59992262EE553FA3
GO
Isoform 2 (identifier: A4FU49-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: MVQSELQLQPRAGGRAEAASWGDRGNDKGG → MIKEIEDGWWLGKKNGQLGAFPSNFVELLDSGPPS

Note: No experimental confirmation available.
Show »
Length:645
Mass (Da):71,238
Checksum:iD7FA6E6957E2036C
GO
Isoform 3 (identifier: A4FU49-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-96: MVQSELQLQP...RRGDVVKVLS → MIKEIEDGWW...SVSPGPQRPP
     173-179: TSRTPSR → RKSTAAR
     180-640: Missing.

Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:135
Mass (Da):14,779
Checksum:i4790D889DFD47599
GO
Isoform 4 (identifier: A4FU49-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     191-232: PNGGFQSGGS...EEHSSPVKAP → GRAQQPGKGP...RPQLQEDPGS
     233-640: Missing.

Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:232
Mass (Da):25,313
Checksum:i0DA164A88407EF27
GO
Isoform 5 (identifier: A4FU49-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: MVQSELQLQPRAGGRAEAASWGDRGNDKGG → MEVLVLAGYR...VELLDSGPPS

Show »
Length:756
Mass (Da):83,970
Checksum:i1B6BA2463B701102
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RD64D6RD64_HUMAN
SH3 domain-containing protein 21
SH3D21
135Annotation score:

Sequence cautioni

The sequence AAI01677 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS.Curated
The sequence AAI01679 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS.Curated
The sequence BAB15504 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAB71191 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS.Curated
The sequence EAX07375 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence EAX07376 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti327K → E in BAB71191 (PubMed:14702039).Curated1
Sequence conflicti413E → G in BAB71191 (PubMed:14702039).Curated1
Sequence conflicti541 – 542TR → NS in BAB71191 (PubMed:14702039).Curated2
Sequence conflicti582E → G in BAB71191 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_043619217S → A. Corresponds to variant dbSNP:rs12121759Ensembl.1
Natural variantiVAR_056763455A → S. Corresponds to variant dbSNP:rs12121759Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0409231 – 96MVQSE…VKVLS → MIKEIEDGWWLGKRNGQLGA FPSNFVELLDSGPPSLGNPD MPSVSPGPQRPP in isoform 3. 2 PublicationsAdd BLAST96
Alternative sequenceiVSP_0409241 – 30MVQSE…NDKGG → MIKEIEDGWWLGKKNGQLGA FPSNFVELLDSGPPS in isoform 2. 2 PublicationsAdd BLAST30
Alternative sequenceiVSP_0459361 – 30MVQSE…NDKGG → MEVLVLAGYRAQKEDELSLA PGDVVRQVRWVPARGWLRGE FGGRYGLFPERLVQEIPETL RGSGEARRPRCARRRGHPAK HPRPQRWCKVNFSYSPEQAD ELKLQAGEIVEMIKEIEDGW WLGKKNGQLGAFPSNFVELL DSGPPS in isoform 5. CuratedAdd BLAST30
Alternative sequenceiVSP_040925173 – 179TSRTPSR → RKSTAAR in isoform 3. 2 Publications7
Alternative sequenceiVSP_040926180 – 640Missing in isoform 3. 2 PublicationsAdd BLAST461
Alternative sequenceiVSP_040927191 – 232PNGGF…PVKAP → GRAQQPGKGPLCEENPHAGQ DCHPREAPSSRERPQLQEDP GS in isoform 4. 1 PublicationAdd BLAST42
Alternative sequenceiVSP_040928233 – 640Missing in isoform 4. 1 PublicationAdd BLAST408

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK026591 mRNA Translation: BAB15504.1 Different initiation.
AK297015 mRNA Translation: BAG59548.1
AK056459 mRNA Translation: BAB71191.1 Sequence problems.
AL591845 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX07374.1
CH471059 Genomic DNA Translation: EAX07375.1 Sequence problems.
CH471059 Genomic DNA Translation: EAX07376.1 Sequence problems.
BC036763 mRNA Translation: AAH36763.1
BC048273 mRNA Translation: AAH48273.1
BC101676 mRNA Translation: AAI01677.1 Sequence problems.
BC101678 mRNA Translation: AAI01679.1 Sequence problems.
CCDSiCCDS30674.2 [A4FU49-3]
RefSeqiNP_001156002.1, NM_001162530.1 [A4FU49-6]
NP_078952.4, NM_024676.4 [A4FU49-3]
XP_016857835.1, XM_017002346.1
UniGeneiHs.524496

Genome annotation databases

EnsembliENST00000453908; ENSP00000403476; ENSG00000214193 [A4FU49-6]
ENST00000505871; ENSP00000421294; ENSG00000214193 [A4FU49-3]
GeneIDi79729
KEGGihsa:79729
UCSCiuc010oia.2 human [A4FU49-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK026591 mRNA Translation: BAB15504.1 Different initiation.
AK297015 mRNA Translation: BAG59548.1
AK056459 mRNA Translation: BAB71191.1 Sequence problems.
AL591845 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX07374.1
CH471059 Genomic DNA Translation: EAX07375.1 Sequence problems.
CH471059 Genomic DNA Translation: EAX07376.1 Sequence problems.
BC036763 mRNA Translation: AAH36763.1
BC048273 mRNA Translation: AAH48273.1
BC101676 mRNA Translation: AAI01677.1 Sequence problems.
BC101678 mRNA Translation: AAI01679.1 Sequence problems.
CCDSiCCDS30674.2 [A4FU49-3]
RefSeqiNP_001156002.1, NM_001162530.1 [A4FU49-6]
NP_078952.4, NM_024676.4 [A4FU49-3]
XP_016857835.1, XM_017002346.1
UniGeneiHs.524496

3D structure databases

ProteinModelPortaliA4FU49
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiA4FU49, 2 interactors
MINTiA4FU49
STRINGi9606.ENSP00000403476

PTM databases

iPTMnetiA4FU49
PhosphoSitePlusiA4FU49

Polymorphism and mutation databases

BioMutaiSH3D21

Proteomic databases

MaxQBiA4FU49
PaxDbiA4FU49
PRIDEiA4FU49
ProteomicsDBi663
664 [A4FU49-3]
665 [A4FU49-4]
666 [A4FU49-5]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000453908; ENSP00000403476; ENSG00000214193 [A4FU49-6]
ENST00000505871; ENSP00000421294; ENSG00000214193 [A4FU49-3]
GeneIDi79729
KEGGihsa:79729
UCSCiuc010oia.2 human [A4FU49-1]

Organism-specific databases

CTDi79729
EuPathDBiHostDB:ENSG00000214193.9
GeneCardsiSH3D21
H-InvDBiHIX0199850
HGNCiHGNC:26236 SH3D21
HPAiHPA042212
HPA042456
HPA066168
neXtProtiNX_A4FU49
OpenTargetsiENSG00000214193
PharmGKBiPA142672497
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4348 Eukaryota
ENOG410XQBY LUCA
GeneTreeiENSGT00530000063594
HOVERGENiHBG107554
InParanoidiA4FU49
OMAiRSKTQTP
OrthoDBiEOG091G08QF
PhylomeDBiA4FU49
TreeFamiTF351294

Miscellaneous databases

ChiTaRSiSH3D21 human
GenomeRNAii79729
PROiPR:A4FU49

Gene expression databases

BgeeiENSG00000214193 Expressed in 169 organ(s), highest expression level in left lobe of thyroid gland
CleanExiHS_C1orf113
ExpressionAtlasiA4FU49 baseline and differential
GenevisibleiA4FU49 HS

Family and domain databases

CDDicd12142 SH3_D21-like, 1 hit
InterProiView protein in InterPro
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR035468 SH3D21_SH3
PfamiView protein in Pfam
PF07653 SH3_2, 1 hit
PRINTSiPR00452 SH3DOMAIN
SMARTiView protein in SMART
SM00326 SH3, 1 hit
SUPFAMiSSF50044 SSF50044, 1 hit
PROSITEiView protein in PROSITE
PS50002 SH3, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiSH321_HUMAN
AccessioniPrimary (citable) accession number: A4FU49
Secondary accession number(s): B4DLI6
, D3DPS6, J3KQM5, Q5VTK7, Q86XZ6, Q8N445, Q96DN4, Q9H5W5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: May 20, 2008
Last modified: November 7, 2018
This is version 98 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again