Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 95 (07 Apr 2021)
Sequence version 1 (20 Mar 2007)
Previous versions | rss
Add a publicationFeedback
Protein

Calcium uptake protein 1 homolog, mitochondrial

Gene

MICU1

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Key regulator of mitochondrial calcium uniporter (MCU) that senses calcium level via its EF-hand domains (Probable). During development, required in alpha/beta or gamma mushroom body neurons to support olfactory intermediate-term memory in the adult (PubMed:27568554).1 Publication1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) of the calcium-binding region(s) within the protein. One common calcium-binding motif is the EF-hand, but other calcium-binding motifs also exist.<p><a href='/help/ca_bind' target='_top'>More...</a></p>Calcium bindingi281 – 2921PROSITE-ProRule annotationAdd BLAST12
Calcium bindingi472 – 4832PROSITE-ProRule annotationAdd BLAST12

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCalcium transport, Ion transport, Transport
LigandCalcium, Metal-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-DME-8949215, Mitochondrial calcium ion transport

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Calcium uptake protein 1 homolog, mitochondrialCurated
Alternative name(s):
Mitochondrial calcium uptake 12 PublicationsImported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MICU12 PublicationsImported
ORF Names:CG4495Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2L

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0031893, MICU1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei77 – 97HelicalSequence analysisAdd BLAST21
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini98 – 525Mitochondrial intermembraneCuratedAdd BLAST428

Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion inner membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

RNAi-mediated knockdown results in lethality (PubMed:27568554). RNAi-mediated knockdown in neurons shortens lifespan and severely impairs climbing ability (PubMed:28198506). RNAi-mediated knockdown in the developing eye decreases ommatidia number and disrupts ommatidial array (PubMed:28198506). RNAi-mediated knockdown in neurons and, more specifically, in alpha/beta or gamma mushroom body neurons, impairs mitochondrial calcium entry and decreases intermediate-term memory after conditioning (PubMed:27568554). Does not affect olfactory learning (PubMed:27568554).2 Publications

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a transit peptide.<p><a href='/help/transit' target='_top'>More...</a></p>Transit peptidei1 – ?MitochondrionSequence analysis
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_0000399812? – 525Calcium uptake protein 1 homolog, mitochondrial

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
A2VEI2

PRoteomics IDEntifications database

More...
PRIDEi
A2VEI2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
FBgn0031893, Expressed in brain and 28 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
A2VEI2, DM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
60145, 1 interactor

STRING: functional protein association networks

More...
STRINGi
7227.FBpp0111941

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
A2VEI2

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini268 – 303EF-hand 1PROSITE-ProRule annotationAdd BLAST36
Domaini459 – 494EF-hand 2PROSITE-ProRule annotationAdd BLAST36

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the MICU1 family. MICU1 subfamily.Curated

Keywords - Domaini

Repeat, Transit peptide, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2643, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000183079

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_027103_3_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
A2VEI2

Identification of Orthologs from Complete Genome Data

More...
OMAi
ERKEPNE

Database for complete collections of gene phylogenies

More...
PhylomeDBi
A2VEI2

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011992, EF-hand-dom_pair
IPR018247, EF_Hand_1_Ca_BS
IPR002048, EF_hand_dom
IPR039800, MICU1/2/3

The PANTHER Classification System

More...
PANTHERi
PTHR12294, PTHR12294, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF13202, EF-hand_5, 1 hit
PF13833, EF-hand_8, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00054, EFh, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47473, SSF47473, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00018, EF_HAND_1, 2 hits
PS50222, EF_HAND_2, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform B (identifier: A2VEI2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSVLRFLVTR QALAALTRPR TLNIIQNPAQ IAYASTLCNQ NSNHNAKDLT
60 70 80 90 100
KSSANLSLMQ TRGHKRFGHQ EEKTPSVTKY FHMFILSLFL ISVMDWGKVK
110 120 130 140 150
RMLTPKVDAD AGQRPSSAAD VNGEDKSSES ESEDSEDEEA GSDLHLHEGK
160 170 180 190 200
KIREKVGFRE RKIIEYENRI RQFSTPDKVF RYFATIQVPV ADDRHEVYMT
210 220 230 240 250
PTDFLTSMTP GMKQPDGLGL DQYRRYDPKS VGEQLNLHLE KNSIFYKLGS
260 270 280 290 300
YGLITFSDYI FLLTVLSISR RHFEIAFRMF DLNGDGDVDC EEFEMVATLV
310 320 330 340 350
RQQTSMGTRH RDHANTGNTF KGVNSALITY FFGPNMDEKL TIEKFLDFQE
360 370 380 390 400
QLQREILSLE FERKEPNDEG NITEADFAEL LLAYAGYPLK KKQKKLKRVK
410 420 430 440 450
RRFRDHGKGI SKQDYLDFFH FLNNINDVDT ALTFYHIAGA SIDQQTLQHV
460 470 480 490 500
AKTVAMVNLS DHVVDVVFTI FDENNDNQLS NKEFISVMKN RVQRGLEKPK
510 520
DTGFLKMMRS VFKCAKETKP VLLDI
Length:525
Mass (Da):60,344
Last modified:March 20, 2007 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iEB00098E8C9C1D23
GO
Isoform A (identifier: A2VEI2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     179-212: VFRYFATIQVPVADDRHEVYMTPTDFLTSMTPGM → IFRYFATVRLQDATQTIVCMTPEDFLRSIYPGI

Show »
Length:524
Mass (Da):60,273
Checksum:i962095003CD6FBAF
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_039911179 – 212VFRYF…MTPGM → IFRYFATVRLQDATQTIVCM TPEDFLRSIYPGI in isoform A. 1 PublicationAdd BLAST34

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AE014134 Genomic DNA Translation: AAF52489.1
AE014134 Genomic DNA Translation: ABV53641.1
AY051995 mRNA Translation: AAK93419.1
BT030151 mRNA Translation: ABN49290.1

NCBI Reference Sequences

More...
RefSeqi
NP_001097110.1, NM_001103640.2 [A2VEI2-1]
NP_609100.1, NM_135256.3 [A2VEI2-2]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0079405; FBpp0079033; FBgn0031893 [A2VEI2-2]
FBtr0113028; FBpp0111941; FBgn0031893 [A2VEI2-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
33999

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dme:Dmel_CG4495

UCSC genome browser

More...
UCSCi
CG4495-RA, d. melanogaster
CG4495-RB, d. melanogaster [A2VEI2-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AE014134 Genomic DNA Translation: AAF52489.1
AE014134 Genomic DNA Translation: ABV53641.1
AY051995 mRNA Translation: AAK93419.1
BT030151 mRNA Translation: ABN49290.1
RefSeqiNP_001097110.1, NM_001103640.2 [A2VEI2-1]
NP_609100.1, NM_135256.3 [A2VEI2-2]

3D structure databases

SMRiA2VEI2
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi60145, 1 interactor
STRINGi7227.FBpp0111941

Proteomic databases

PaxDbiA2VEI2
PRIDEiA2VEI2

Genome annotation databases

EnsemblMetazoaiFBtr0079405; FBpp0079033; FBgn0031893 [A2VEI2-2]
FBtr0113028; FBpp0111941; FBgn0031893 [A2VEI2-1]
GeneIDi33999
KEGGidme:Dmel_CG4495
UCSCiCG4495-RA, d. melanogaster
CG4495-RB, d. melanogaster [A2VEI2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
10367
FlyBaseiFBgn0031893, MICU1

Phylogenomic databases

eggNOGiKOG2643, Eukaryota
GeneTreeiENSGT00950000183079
HOGENOMiCLU_027103_3_0_1
InParanoidiA2VEI2
OMAiERKEPNE
PhylomeDBiA2VEI2

Enzyme and pathway databases

ReactomeiR-DME-8949215, Mitochondrial calcium ion transport

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
33999, 0 hits in 1 CRISPR screen

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CG4495, fly

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
33999

Protein Ontology

More...
PROi
PR:A2VEI2

Gene expression databases

BgeeiFBgn0031893, Expressed in brain and 28 other tissues
GenevisibleiA2VEI2, DM

Family and domain databases

InterProiView protein in InterPro
IPR011992, EF-hand-dom_pair
IPR018247, EF_Hand_1_Ca_BS
IPR002048, EF_hand_dom
IPR039800, MICU1/2/3
PANTHERiPTHR12294, PTHR12294, 1 hit
PfamiView protein in Pfam
PF13202, EF-hand_5, 1 hit
PF13833, EF-hand_8, 1 hit
SMARTiView protein in SMART
SM00054, EFh, 2 hits
SUPFAMiSSF47473, SSF47473, 2 hits
PROSITEiView protein in PROSITE
PS00018, EF_HAND_1, 2 hits
PS50222, EF_HAND_2, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMICU1_DROME
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A2VEI2
Secondary accession number(s): Q9VM38
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 5, 2010
Last sequence update: March 20, 2007
Last modified: April 7, 2021
This is version 95 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again