Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Coiled-coil domain-containing protein 144A

Gene

CCDC144A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Coiled-coil domain-containing protein 144A
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CCDC144A
Synonyms:KIAA0565
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000170160.16

Human Gene Nomenclature Database

More...
HGNCi
HGNC:29072 CCDC144A

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_A2RUR9

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000170160

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162381473

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CCDC144A

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003122791 – 1427Coiled-coil domain-containing protein 144AAdd BLAST1427

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
A2RUR9

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
A2RUR9

PRoteomics IDEntifications database

More...
PRIDEi
A2RUR9

ProteomicsDB human proteome resource

More...
ProteomicsDBi
516
517 [A2RUR9-2]
518 [A2RUR9-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
A2RUR9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
A2RUR9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000170160 Expressed in 87 organ(s), highest expression level in corpus callosum

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
A2RUR9 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
A2RUR9 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA022996
HPA047220
HPA047851

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
115069, 2 interactors

Protein interaction database and analysis system

More...
IntActi
A2RUR9, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000353717

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
A2RUR9

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
A2RUR9

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili490 – 545Sequence analysisAdd BLAST56
Coiled coili648 – 1129Sequence analysisAdd BLAST482
Coiled coili1155 – 1309Sequence analysisAdd BLAST155

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi1394 – 1400Poly-Ser7

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the CCDC144 family.Curated

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410JA18 Eukaryota
ENOG4111BDS LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000166080

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000098303

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG107542

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
A2RUR9

Identification of Orthologs from Complete Genome Data

More...
OMAi
DSEHVEG

Database of Orthologous Groups

More...
OrthoDBi
305292at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
A2RUR9

TreeFam database of animal gene trees

More...
TreeFami
TF342629

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR040118 C144
IPR039497 CC144C-like_CC_dom
IPR021885 DUF3496

The PANTHER Classification System

More...
PANTHERi
PTHR22245 PTHR22245, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF14915 CCDC144C, 1 hit
PF12001 DUF3496, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: A2RUR9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASWGGEKRG GAEGSPKPAV YATRKTPSVG SQGDQWYLGY PGDQWSSGFP
60 70 80 90 100
YSWWKNSVGS ESKHGEGALD QPQHDVRLED LGELHRAARS GDVPGVEHIL
110 120 130 140 150
APGDTGVDKR DRKKSIQQLV PEYKEKQTPE SLPQNNNPDW HPTNLTLSDE
160 170 180 190 200
TCQRSKNLKV DDKCPSVSPS MPENQSATKE LGQMNLTERE KMDTGVVLLS
210 220 230 240 250
GNDTLHDLCQ SQLPENKESK EAEQDSELTS EEEQERLKGC ENKQPQKTSQ
260 270 280 290 300
EPEMAKDCDR EDIPIYPVLP HVQKSEEMWI EQGKLEWKNQ LKLVINELKQ
310 320 330 340 350
RFGEIYEKYK IPACPEEEPL LDNSTRGTDV KDIPFNLTNN IPGCEEEDAS
360 370 380 390 400
EISVSVVFET FPEQKEPSLK NIIHPYYHPY SGSQEHVCQS SSKFHLHENK
410 420 430 440 450
LDCDNDNKPG IGHIFSTDKN FHNDASTKKA RNPEVVMVEM KEDQEFDLQM
460 470 480 490 500
TKNMNQNSDS GSTNNYKSLK PKLENLSSLP PDSDRTSEVY LHEELQQDMQ
510 520 530 540 550
KFKNEVNTLE EEFLALKKED VQLHKDVEEE MEKHRSNSTE LSGTLTDGTT
560 570 580 590 600
VGNDDDGLNQ QIPRKENGEH DRPADKTSNE KNEVKNQIYP EADFADSMEP
610 620 630 640 650
SEIASEDCEL SHSVYENFML LIEQLRMEYK DSASLPRIQD TFCLCEHLLK
660 670 680 690 700
LKNNHCDQLT VKLKQMENMV SVLQNELSET KKTKLQLELQ KIEWEKELYD
710 720 730 740 750
LRLALKQENE EKRNADMLYN KDSEQLRIKE EECGKVVETK QQLKWNLRRL
760 770 780 790 800
VKELRTVRNN LDLVVQERND AQKQLSEEQD ARILQDQILT SKQKELEMAR
810 820 830 840 850
KKMNSEISHR HQKEKDLFHE DCMLQEEIAL LRLEIDTIKN QNKQKEKKYF
860 870 880 890 900
EDIEAVKEKN DNLQKIIKLN EETLTETILQ YSGQLNNLTA ENKILNSELE
910 920 930 940 950
NGKQNQERLE IEMESYRCRL AAAVRDCDQS QTARDLKLDF QRTRQEWVRL
960 970 980 990 1000
HDKMKVDMSG LQAKNEILSE KLSNAESKIN SLQIQLHNTR DALGRESLIL
1010 1020 1030 1040 1050
ERVQRDLSQT QCQKKETEQM YQIEQSKLKK YIAKQESVEE RLSQLQSENM
1060 1070 1080 1090 1100
LLRQQLDDAH KKANSQEKTS STIQDQFHSA AKNLQAESEK QILSLQEKNK
1110 1120 1130 1140 1150
ELMDEYNHLK ERMDQCEKEK AGRKIDLTEA QETVPSRCLH LDAENEVLQL
1160 1170 1180 1190 1200
QQTLFSMKAI QKQCETLQKN KKQLKQEVVN LKSYMERNML ERGKAEWHKL
1210 1220 1230 1240 1250
LIEERARKEI EEKLNEAILT LQKQAAVSHE QLVQLREDNT TSIKTQMELT
1260 1270 1280 1290 1300
IKDLESEISR IKTSQADFNK TELERYKELY LEEVKVRESL SNELSRTNEM
1310 1320 1330 1340 1350
IAEVSTQLTV EKEQTRSRSL FTAYATRPVL ESPCVGNLND SEGLNRKHIP
1360 1370 1380 1390 1400
RKKRSALKDM ESYLLKMQQK LQNDLTAEVA GSSQTGLHRI PQCSSFSSSS
1410 1420
LHLLLCSICQ PFFLILQLLL NMNLDPI
Length:1,427
Mass (Da):165,125
Last modified:March 6, 2007 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i9538A4F523D8D5C5
GO
Isoform 2 (identifier: A2RUR9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-697: Missing.
     698-701: LYDL → MFNC
     1367-1427: MQQKLQNDLT...LLLNMNLDPI → VSYLFSFGVQISDRILVCYLVK

Note: No experimental confirmation available.
Show »
Length:691
Mass (Da):81,413
Checksum:i7EC2982584939442
GO
Isoform 3 (identifier: A2RUR9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     247-526: Missing.
     1124-1124: K → KVVMREFQQEWTDLLKQQPTSEATSRCHINLDETQDSKKKLGQIRSE
     1367-1427: MQQKLQNDLT...LLLNMNLDPI → VSYLFSFGVQISDRILVCYLVK

Show »
Length:1,154
Mass (Da):133,874
Checksum:i0A3298D43B081F1D
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JT67C9JT67_HUMAN
Coiled-coil domain-containing prote...
CCDC144A
1,425Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A6NJB5A6NJB5_HUMAN
Coiled-coil domain-containing prote...
CCDC144A
571Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A6NG92A6NG92_HUMAN
CCDC144A protein
CCDC144A
726Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WSY3A0A087WSY3_HUMAN
Coiled-coil domain-containing prote...
CCDC144A
725Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JAY6C9JAY6_HUMAN
Coiled-coil domain-containing prote...
CCDC144A
178Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA25491 differs from that shown. Reason: Frameshift at position 1322.Curated
The sequence BAA25491 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAC86369 differs from that shown. Reason: Frameshift at position 953.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti1085Q → R in BAC86369 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0297871 – 697Missing in isoform 2. 1 PublicationAdd BLAST697
Alternative sequenceiVSP_029788247 – 526Missing in isoform 3. 1 PublicationAdd BLAST280
Alternative sequenceiVSP_029789698 – 701LYDL → MFNC in isoform 2. 1 Publication4
Alternative sequenceiVSP_0297901124K → KVVMREFQQEWTDLLKQQPT SEATSRCHINLDETQDSKKK LGQIRSE in isoform 3. 1 Publication1
Alternative sequenceiVSP_0297911367 – 1427MQQKL…NLDPI → VSYLFSFGVQISDRILVCYL VK in isoform 2 and isoform 3. 2 PublicationsAdd BLAST61

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB011137 mRNA Translation: BAA25491.2 Sequence problems.
AC098850 Genomic DNA No translation available.
BC133019 mRNA Translation: AAI33020.1
AK125971 mRNA Translation: BAC86369.1 Frameshift.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS45621.1 [A2RUR9-1]

NCBI Reference Sequences

More...
RefSeqi
NP_055510.1, NM_014695.2 [A2RUR9-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.745246

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000360524; ENSP00000353717; ENSG00000170160 [A2RUR9-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9720

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:9720

UCSC genome browser

More...
UCSCi
uc002gqk.2 human [A2RUR9-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB011137 mRNA Translation: BAA25491.2 Sequence problems.
AC098850 Genomic DNA No translation available.
BC133019 mRNA Translation: AAI33020.1
AK125971 mRNA Translation: BAC86369.1 Frameshift.
CCDSiCCDS45621.1 [A2RUR9-1]
RefSeqiNP_055510.1, NM_014695.2 [A2RUR9-1]
UniGeneiHs.745246

3D structure databases

ProteinModelPortaliA2RUR9
SMRiA2RUR9
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115069, 2 interactors
IntActiA2RUR9, 1 interactor
STRINGi9606.ENSP00000353717

PTM databases

iPTMnetiA2RUR9
PhosphoSitePlusiA2RUR9

Polymorphism and mutation databases

BioMutaiCCDC144A

Proteomic databases

EPDiA2RUR9
PaxDbiA2RUR9
PRIDEiA2RUR9
ProteomicsDBi516
517 [A2RUR9-2]
518 [A2RUR9-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000360524; ENSP00000353717; ENSG00000170160 [A2RUR9-1]
GeneIDi9720
KEGGihsa:9720
UCSCiuc002gqk.2 human [A2RUR9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9720
EuPathDBiHostDB:ENSG00000170160.16

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CCDC144A
HGNCiHGNC:29072 CCDC144A
HPAiHPA022996
HPA047220
HPA047851
neXtProtiNX_A2RUR9
OpenTargetsiENSG00000170160
PharmGKBiPA162381473

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410JA18 Eukaryota
ENOG4111BDS LUCA
GeneTreeiENSGT00940000166080
HOGENOMiHOG000098303
HOVERGENiHBG107542
InParanoidiA2RUR9
OMAiDSEHVEG
OrthoDBi305292at2759
PhylomeDBiA2RUR9
TreeFamiTF342629

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
9720

Protein Ontology

More...
PROi
PR:A2RUR9

Gene expression databases

BgeeiENSG00000170160 Expressed in 87 organ(s), highest expression level in corpus callosum
ExpressionAtlasiA2RUR9 baseline and differential
GenevisibleiA2RUR9 HS

Family and domain databases

InterProiView protein in InterPro
IPR040118 C144
IPR039497 CC144C-like_CC_dom
IPR021885 DUF3496
PANTHERiPTHR22245 PTHR22245, 1 hit
PfamiView protein in Pfam
PF14915 CCDC144C, 1 hit
PF12001 DUF3496, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiC144A_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A2RUR9
Secondary accession number(s): O60311, Q6ZU57
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 4, 2007
Last sequence update: March 6, 2007
Last modified: January 16, 2019
This is version 87 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again