Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 94 (13 Feb 2019)
Sequence version 2 (03 Mar 2009)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Protein HEATR9

Gene

HEATR9

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Caution

Despite its name, the presence of HEAT repeat is unsure and is not confirmed by repeat-detection programs.Curated

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein HEATR9
Alternative name(s):
HEAT repeat-containing protein 9
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:HEATR9
Synonyms:C17orf66
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000270379.5

Human Gene Nomenclature Database

More...
HGNCi
HGNC:26548 HEATR9

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_A2RTY3

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000270379

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142672249

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
HEATR9

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002871761 – 570Protein HEATR9Add BLAST570

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
A2RTY3

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
A2RTY3

PRoteomics IDEntifications database

More...
PRIDEi
A2RTY3

ProteomicsDB human proteome resource

More...
ProteomicsDBi
485
486 [A2RTY3-2]
487 [A2RTY3-3]
488 [A2RTY3-4]
489 [A2RTY3-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
A2RTY3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
A2RTY3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000270379 Expressed in 47 organ(s), highest expression level in testis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
A2RTY3 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
A2RTY3 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA023129

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
A2RTY3, 2 interactors

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
A2RTY3

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
A2RTY3

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IGFK Eukaryota
ENOG4111TMS LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000007247

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000111939

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG096807

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
A2RTY3

Identification of Orthologs from Complete Genome Data

More...
OMAi
PPSPECW

Database of Orthologous Groups

More...
OrthoDBi
1319138at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
A2RTY3

TreeFam database of animal gene trees

More...
TreeFami
TF338240

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.10.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011989 ARM-like
IPR016024 ARM-type_fold

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48371 SSF48371, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: A2RTY3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAYEKSTDIS DVSRSMFLYP WLEYPDKTKE LRKAMAPVHL PLSCYQMPKE
60 70 80 90 100
EFPPSPECWR QHPSKPNSVP YCYFKKPEIY THWHDLYDQR EEREAEKMLR
110 120 130 140 150
KMRDDCRYIK EVHQTHIKMF HLPMSKLTIK SEMRSRPLEP TQDPLKWQRL
160 170 180 190 200
RELTKSLESP REDEQFYAAQ ALGCLRISDK FVMEALQQVA QTGPEKVKYE
210 220 230 240 250
AYRTLAILGC LNKHVIRALI KQLKEKNEGQ RMETLTGLRM ALNSWAAVSK
260 270 280 290 300
DKRTQVGDEG KLVPVLQTLI KKSSSEASLE AALCLGFLRP CSNMVQEFLL
310 320 330 340 350
QCLCQGLKTQ RMKALRMLVK VMHVHSAPVI KAILDQLCSS SVLEDRFEAT
360 370 380 390 400
QMLKTIGLEQ IQAQGLEELT FNLLRRKTHN EPFLAVRQAV AQTVEELKLK
410 420 430 440 450
PTMMNLVEAQ LMNPDATARQ EAVISLGVLG IRSPQVFHLL LDLLDAENHQ
460 470 480 490 500
AVKKSLQETL ILCASIDPWI QNKLKNKVLS VYEAPKTNVK AEPTRFQKEP
510 520 530 540 550
ENPEELTIQD FRLAKLNPLF IAKSITKVGQ KKTPAFPPCC SKPRKHRPQV
560 570
IGPWQPRIKK QLRVLAEIAK
Length:570
Mass (Da):65,681
Last modified:March 3, 2009 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i9DA537D04033B2DA
GO
Isoform 2 (identifier: A2RTY3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     190-219: AQTGPEKVKYEAYRTLAILGCLNKHVIRAL → VSLRTAGVQERRKQGLRCVACGHRRGSPGC
     220-570: Missing.

Note: No experimental confirmation available.
Show »
Length:219
Mass (Da):26,052
Checksum:i4B9F3C62C3140BC7
GO
Isoform 3 (identifier: A2RTY3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     112-151: Missing.

Show »
Length:530
Mass (Da):60,803
Checksum:iE6A5B1CD53A45385
GO
Isoform 4 (identifier: A2RTY3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: Missing.
     410-414: QLMNP → NKRRK
     415-570: Missing.

Show »
Length:380
Mass (Da):44,087
Checksum:iBC8D912ECAAEAA31
GO
Isoform 5 (identifier: A2RTY3-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: Missing.
     112-151: Missing.
     410-414: QLMNP → NKRRK
     415-570: Missing.

Show »
Length:340
Mass (Da):39,209
Checksum:i15AB0AE6616AA13B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A075B7D3A0A075B7D3_HUMAN
Protein HEATR9
HEATR9
283Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A075B7D1A0A075B7D1_HUMAN
Protein HEATR9
HEATR9
140Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti3Y → C in AAI32682 (PubMed:15489334).Curated1
Sequence conflicti222Q → R in BAB71466 (PubMed:14702039).Curated1
Sequence conflicti400K → R in BAG63233 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_035685330I → M in a breast cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_032281480S → F1 PublicationCorresponds to variant dbSNP:rs2306630Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0364931 – 34Missing in isoform 4 and isoform 5. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_036494112 – 151Missing in isoform 3 and isoform 5. 1 PublicationAdd BLAST40
Alternative sequenceiVSP_025349190 – 219AQTGP…VIRAL → VSLRTAGVQERRKQGLRCVA CGHRRGSPGC in isoform 2. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_025350220 – 570Missing in isoform 2. 1 PublicationAdd BLAST351
Alternative sequenceiVSP_036495410 – 414QLMNP → NKRRK in isoform 4 and isoform 5. 1 Publication5
Alternative sequenceiVSP_036496415 – 570Missing in isoform 4 and isoform 5. 1 PublicationAdd BLAST156

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK057392 mRNA Translation: BAB71466.1
AK301774 mRNA Translation: BAG63233.1
AK301884 mRNA Translation: BAG63316.1
AK301943 mRNA Translation: BAG63362.1
AC015849 Genomic DNA No translation available.
BC033734 mRNA Translation: AAH33734.1
BC132681 mRNA Translation: AAI32682.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS11299.1 [A2RTY3-1]
CCDS82108.1 [A2RTY3-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001308324.1, NM_001321395.1 [A2RTY3-3]
NP_689994.2, NM_152781.3 [A2RTY3-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.514820

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000603852; ENSP00000474899; ENSG00000270379 [A2RTY3-4]
ENST00000603870; ENSP00000473760; ENSG00000270379 [A2RTY3-3]
ENST00000604834; ENSP00000473941; ENSG00000270379 [A2RTY3-1]
ENST00000605080; ENSP00000474893; ENSG00000270379 [A2RTY3-5]
ENST00000614305; ENSP00000479676; ENSG00000276986 [A2RTY3-1]
ENST00000632179; ENSP00000488053; ENSG00000276986 [A2RTY3-5]
ENST00000632969; ENSP00000488224; ENSG00000276986 [A2RTY3-3]
ENST00000633642; ENSP00000487778; ENSG00000276986 [A2RTY3-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
256957

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:256957

UCSC genome browser

More...
UCSCi
uc002hke.2 human [A2RTY3-1]

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK057392 mRNA Translation: BAB71466.1
AK301774 mRNA Translation: BAG63233.1
AK301884 mRNA Translation: BAG63316.1
AK301943 mRNA Translation: BAG63362.1
AC015849 Genomic DNA No translation available.
BC033734 mRNA Translation: AAH33734.1
BC132681 mRNA Translation: AAI32682.1
CCDSiCCDS11299.1 [A2RTY3-1]
CCDS82108.1 [A2RTY3-3]
RefSeqiNP_001308324.1, NM_001321395.1 [A2RTY3-3]
NP_689994.2, NM_152781.3 [A2RTY3-1]
UniGeneiHs.514820

3D structure databases

ProteinModelPortaliA2RTY3
SMRiA2RTY3
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiA2RTY3, 2 interactors

PTM databases

iPTMnetiA2RTY3
PhosphoSitePlusiA2RTY3

Polymorphism and mutation databases

BioMutaiHEATR9

Proteomic databases

jPOSTiA2RTY3
PaxDbiA2RTY3
PRIDEiA2RTY3
ProteomicsDBi485
486 [A2RTY3-2]
487 [A2RTY3-3]
488 [A2RTY3-4]
489 [A2RTY3-5]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
256957
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000603852; ENSP00000474899; ENSG00000270379 [A2RTY3-4]
ENST00000603870; ENSP00000473760; ENSG00000270379 [A2RTY3-3]
ENST00000604834; ENSP00000473941; ENSG00000270379 [A2RTY3-1]
ENST00000605080; ENSP00000474893; ENSG00000270379 [A2RTY3-5]
ENST00000614305; ENSP00000479676; ENSG00000276986 [A2RTY3-1]
ENST00000632179; ENSP00000488053; ENSG00000276986 [A2RTY3-5]
ENST00000632969; ENSP00000488224; ENSG00000276986 [A2RTY3-3]
ENST00000633642; ENSP00000487778; ENSG00000276986 [A2RTY3-4]
GeneIDi256957
KEGGihsa:256957
UCSCiuc002hke.2 human [A2RTY3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
256957
EuPathDBiHostDB:ENSG00000270379.5

GeneCards: human genes, protein and diseases

More...
GeneCardsi
HEATR9

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0013736
HIX0020441
HGNCiHGNC:26548 HEATR9
HPAiHPA023129
neXtProtiNX_A2RTY3
OpenTargetsiENSG00000270379
PharmGKBiPA142672249

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IGFK Eukaryota
ENOG4111TMS LUCA
GeneTreeiENSGT00390000007247
HOGENOMiHOG000111939
HOVERGENiHBG096807
InParanoidiA2RTY3
OMAiPPSPECW
OrthoDBi1319138at2759
PhylomeDBiA2RTY3
TreeFamiTF338240

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
HEATR9 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
256957

Protein Ontology

More...
PROi
PR:A2RTY3

Gene expression databases

BgeeiENSG00000270379 Expressed in 47 organ(s), highest expression level in testis
ExpressionAtlasiA2RTY3 baseline and differential
GenevisibleiA2RTY3 HS

Family and domain databases

Gene3Di1.25.10.10, 1 hit
InterProiView protein in InterPro
IPR011989 ARM-like
IPR016024 ARM-type_fold
SUPFAMiSSF48371 SSF48371, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiHEAT9_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A2RTY3
Secondary accession number(s): B4DX21
, B4DXA4, B4DXF0, Q8N4R4, Q96M46
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 15, 2007
Last sequence update: March 3, 2009
Last modified: February 13, 2019
This is version 94 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again