Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 67 (13 Feb 2019)
Sequence version 1 (06 Mar 2007)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Spermatogenesis-associated serine-rich protein 1

Gene

Spats1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Spermatogenesis-associated serine-rich protein 1
Alternative name(s):
Dvl2-DEP domain-interacting protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Spats1
Synonyms:Ddip
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1918270 Spats1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003076951 – 269Spermatogenesis-associated serine-rich protein 1Add BLAST269

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei54PhosphothreonineCombined sources1
Modified residuei72PhosphoserineBy similarity1
Modified residuei75PhosphoserineBy similarity1
Modified residuei82PhosphoserineBy similarity1

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQB - The MaxQuant DataBase

More...
MaxQBi
A2RRY8

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
A2RRY8

PRoteomics IDEntifications database

More...
PRIDEi
A2RRY8

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
A2RRY8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
A2RRY8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000023935 Expressed in 50 organ(s), highest expression level in testis

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
A2RRY8 MM

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi67 – 86Ser-richAdd BLAST20

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IZX9 Eukaryota
ENOG4112BAP LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000006786

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000154370

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG098034

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
A2RRY8

Identification of Orthologs from Complete Genome Data

More...
OMAi
YPEQSKD

Database of Orthologous Groups

More...
OrthoDBi
1532791at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
A2RRY8

TreeFam database of animal gene trees

More...
TreeFami
TF337302

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR029165 SASRP1

The PANTHER Classification System

More...
PANTHERi
PTHR35845 PTHR35845, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF15160 SASRP1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: A2RRY8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MESSKDTQHG DALESKSCLA NRTSSRQNKR TSLSSSDGTG PRVTESLGLP
60 70 80 90 100
RVLTPSDTAA ELGQKTSSSS SSSSSSAQSN RSSKVSLPEI PKEKYPEEFS
110 120 130 140 150
LLNSQTEDGQ RPEWTFYPRF SSNIHTYHIG KQCFFNGVFR GNRRSVAERT
160 170 180 190 200
VDNSLGKKKY DIDPRNGIPK LTPGDNPYMF PEQSKEFFKA GATLPPVNFS
210 220 230 240 250
LGPYEKKFDT FIPLEPLPKI PNLPFWEKEK ANNLKNEIKE VEELDNWQVP
260
MPFLHGFFST GASNFSRQQ
Length:269
Mass (Da):30,169
Last modified:March 6, 2007 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDD895E4897EE737F
GO
Isoform 2 (identifier: A2RRY8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     262-269: ASNFSRQQ → TGEMAPRLKVLAALPEGTSSVLSTQGRLTTPCSSSIRGSQTLFLPHRTSSHVLRTYTRTLHINKKP

Show »
Length:327
Mass (Da):36,420
Checksum:i4433D94631091274
GO
Isoform 3 (identifier: A2RRY8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     202-222: Missing.
     262-269: ASNFSRQQ → TGEMAPRLKVLAALPEGTSSVLSTQGRLTTPCSSSIRGSQTLFLPHRTSSHVLRTYTRTLHINKKP

Note: No experimental confirmation available.
Show »
Length:306
Mass (Da):33,994
Checksum:i40DEDF80922B9270
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti61 – 62EL → DV in BAB24285 (PubMed:16141072).Curated2
Sequence conflicti90I → D in BAB24285 (PubMed:16141072).Curated1
Sequence conflicti208F → L in BAB24285 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_028788202 – 222Missing in isoform 3. 1 PublicationAdd BLAST21
Alternative sequenceiVSP_028789262 – 269ASNFSRQQ → TGEMAPRLKVLAALPEGTSS VLSTQGRLTTPCSSSIRGSQ TLFLPHRTSSHVLRTYTRTL HINKKP in isoform 2 and isoform 3. 2 Publications8

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY336501 mRNA Translation: AAQ88273.1
AK005865 mRNA Translation: BAB24285.1
AK016586 mRNA Translation: BAB30325.1
BC131909 mRNA Translation: AAI31910.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS50118.1 [A2RRY8-1]

NCBI Reference Sequences

More...
RefSeqi
NP_081925.2, NM_027649.3 [A2RRY8-1]
XP_006524978.1, XM_006524915.2
XP_006524980.1, XM_006524917.2

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Mm.44257

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000024731; ENSMUSP00000024731; ENSMUSG00000023935 [A2RRY8-1]
ENSMUST00000233553; ENSMUSP00000156716; ENSMUSG00000023935 [A2RRY8-2]
ENSMUST00000233769; ENSMUSP00000156469; ENSMUSG00000023935 [A2RRY8-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
71020

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:71020

UCSC genome browser

More...
UCSCi
uc008cqn.1 mouse [A2RRY8-2]
uc008cqo.1 mouse [A2RRY8-3]
uc008cqp.1 mouse [A2RRY8-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY336501 mRNA Translation: AAQ88273.1
AK005865 mRNA Translation: BAB24285.1
AK016586 mRNA Translation: BAB30325.1
BC131909 mRNA Translation: AAI31910.1
CCDSiCCDS50118.1 [A2RRY8-1]
RefSeqiNP_081925.2, NM_027649.3 [A2RRY8-1]
XP_006524978.1, XM_006524915.2
XP_006524980.1, XM_006524917.2
UniGeneiMm.44257

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

PTM databases

iPTMnetiA2RRY8
PhosphoSitePlusiA2RRY8

Proteomic databases

MaxQBiA2RRY8
PaxDbiA2RRY8
PRIDEiA2RRY8

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000024731; ENSMUSP00000024731; ENSMUSG00000023935 [A2RRY8-1]
ENSMUST00000233553; ENSMUSP00000156716; ENSMUSG00000023935 [A2RRY8-2]
ENSMUST00000233769; ENSMUSP00000156469; ENSMUSG00000023935 [A2RRY8-3]
GeneIDi71020
KEGGimmu:71020
UCSCiuc008cqn.1 mouse [A2RRY8-2]
uc008cqo.1 mouse [A2RRY8-3]
uc008cqp.1 mouse [A2RRY8-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
221409
MGIiMGI:1918270 Spats1

Phylogenomic databases

eggNOGiENOG410IZX9 Eukaryota
ENOG4112BAP LUCA
GeneTreeiENSGT00390000006786
HOGENOMiHOG000154370
HOVERGENiHBG098034
InParanoidiA2RRY8
OMAiYPEQSKD
OrthoDBi1532791at2759
PhylomeDBiA2RRY8
TreeFamiTF337302

Miscellaneous databases

Protein Ontology

More...
PROi
PR:A2RRY8

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000023935 Expressed in 50 organ(s), highest expression level in testis
GenevisibleiA2RRY8 MM

Family and domain databases

InterProiView protein in InterPro
IPR029165 SASRP1
PANTHERiPTHR35845 PTHR35845, 1 hit
PfamiView protein in Pfam
PF15160 SASRP1, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSPAS1_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A2RRY8
Secondary accession number(s): Q6VNB9, Q9CUD9, Q9DAG2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: March 6, 2007
Last modified: February 13, 2019
This is version 67 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again