Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Spermatogenesis-associated serine-rich protein 1

Gene

Spats1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Spermatogenesis-associated serine-rich protein 1
Alternative name(s):
Dvl2-DEP domain-interacting protein
Gene namesi
Name:Spats1
Synonyms:Ddip
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 17

Organism-specific databases

MGIiMGI:1918270 Spats1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003076951 – 269Spermatogenesis-associated serine-rich protein 1Add BLAST269

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei54PhosphothreonineCombined sources1
Modified residuei72PhosphoserineBy similarity1
Modified residuei75PhosphoserineBy similarity1
Modified residuei82PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiA2RRY8
PaxDbiA2RRY8
PRIDEiA2RRY8

PTM databases

iPTMnetiA2RRY8
PhosphoSitePlusiA2RRY8

Expressioni

Gene expression databases

BgeeiENSMUSG00000023935 Expressed in 50 organ(s), highest expression level in testis
CleanExiMM_SPATS1
GenevisibleiA2RRY8 MM

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi67 – 86Ser-richAdd BLAST20

Phylogenomic databases

eggNOGiENOG410IZX9 Eukaryota
ENOG4112BAP LUCA
GeneTreeiENSGT00390000006786
HOGENOMiHOG000154370
HOVERGENiHBG098034
InParanoidiA2RRY8
OMAiYPEQSKD
OrthoDBiEOG091G0RZH
PhylomeDBiA2RRY8
TreeFamiTF337302

Family and domain databases

InterProiView protein in InterPro
IPR029165 SASRP1
PANTHERiPTHR35845 PTHR35845, 1 hit
PfamiView protein in Pfam
PF15160 SASRP1, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: A2RRY8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MESSKDTQHG DALESKSCLA NRTSSRQNKR TSLSSSDGTG PRVTESLGLP
60 70 80 90 100
RVLTPSDTAA ELGQKTSSSS SSSSSSAQSN RSSKVSLPEI PKEKYPEEFS
110 120 130 140 150
LLNSQTEDGQ RPEWTFYPRF SSNIHTYHIG KQCFFNGVFR GNRRSVAERT
160 170 180 190 200
VDNSLGKKKY DIDPRNGIPK LTPGDNPYMF PEQSKEFFKA GATLPPVNFS
210 220 230 240 250
LGPYEKKFDT FIPLEPLPKI PNLPFWEKEK ANNLKNEIKE VEELDNWQVP
260
MPFLHGFFST GASNFSRQQ
Length:269
Mass (Da):30,169
Last modified:March 6, 2007 - v1
Checksum:iDD895E4897EE737F
GO
Isoform 2 (identifier: A2RRY8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     262-269: ASNFSRQQ → TGEMAPRLKVLAALPEGTSSVLSTQGRLTTPCSSSIRGSQTLFLPHRTSSHVLRTYTRTLHINKKP

Show »
Length:327
Mass (Da):36,420
Checksum:i4433D94631091274
GO
Isoform 3 (identifier: A2RRY8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     202-222: Missing.
     262-269: ASNFSRQQ → TGEMAPRLKVLAALPEGTSSVLSTQGRLTTPCSSSIRGSQTLFLPHRTSSHVLRTYTRTLHINKKP

Note: No experimental confirmation available.
Show »
Length:306
Mass (Da):33,994
Checksum:i40DEDF80922B9270
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti61 – 62EL → DV in BAB24285 (PubMed:16141072).Curated2
Sequence conflicti90I → D in BAB24285 (PubMed:16141072).Curated1
Sequence conflicti208F → L in BAB24285 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_028788202 – 222Missing in isoform 3. 1 PublicationAdd BLAST21
Alternative sequenceiVSP_028789262 – 269ASNFSRQQ → TGEMAPRLKVLAALPEGTSS VLSTQGRLTTPCSSSIRGSQ TLFLPHRTSSHVLRTYTRTL HINKKP in isoform 2 and isoform 3. 2 Publications8

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY336501 mRNA Translation: AAQ88273.1
AK005865 mRNA Translation: BAB24285.1
AK016586 mRNA Translation: BAB30325.1
BC131909 mRNA Translation: AAI31910.1
CCDSiCCDS50118.1 [A2RRY8-1]
RefSeqiNP_081925.2, NM_027649.3 [A2RRY8-1]
XP_006524978.1, XM_006524915.2
XP_006524980.1, XM_006524917.2
UniGeneiMm.44257

Genome annotation databases

EnsembliENSMUST00000024731; ENSMUSP00000024731; ENSMUSG00000023935 [A2RRY8-1]
GeneIDi71020
KEGGimmu:71020
UCSCiuc008cqn.1 mouse [A2RRY8-2]
uc008cqo.1 mouse [A2RRY8-3]
uc008cqp.1 mouse [A2RRY8-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY336501 mRNA Translation: AAQ88273.1
AK005865 mRNA Translation: BAB24285.1
AK016586 mRNA Translation: BAB30325.1
BC131909 mRNA Translation: AAI31910.1
CCDSiCCDS50118.1 [A2RRY8-1]
RefSeqiNP_081925.2, NM_027649.3 [A2RRY8-1]
XP_006524978.1, XM_006524915.2
XP_006524980.1, XM_006524917.2
UniGeneiMm.44257

3D structure databases

ModBaseiSearch...
MobiDBiSearch...

PTM databases

iPTMnetiA2RRY8
PhosphoSitePlusiA2RRY8

Proteomic databases

MaxQBiA2RRY8
PaxDbiA2RRY8
PRIDEiA2RRY8

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000024731; ENSMUSP00000024731; ENSMUSG00000023935 [A2RRY8-1]
GeneIDi71020
KEGGimmu:71020
UCSCiuc008cqn.1 mouse [A2RRY8-2]
uc008cqo.1 mouse [A2RRY8-3]
uc008cqp.1 mouse [A2RRY8-1]

Organism-specific databases

CTDi221409
MGIiMGI:1918270 Spats1

Phylogenomic databases

eggNOGiENOG410IZX9 Eukaryota
ENOG4112BAP LUCA
GeneTreeiENSGT00390000006786
HOGENOMiHOG000154370
HOVERGENiHBG098034
InParanoidiA2RRY8
OMAiYPEQSKD
OrthoDBiEOG091G0RZH
PhylomeDBiA2RRY8
TreeFamiTF337302

Miscellaneous databases

PROiPR:A2RRY8
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000023935 Expressed in 50 organ(s), highest expression level in testis
CleanExiMM_SPATS1
GenevisibleiA2RRY8 MM

Family and domain databases

InterProiView protein in InterPro
IPR029165 SASRP1
PANTHERiPTHR35845 PTHR35845, 1 hit
PfamiView protein in Pfam
PF15160 SASRP1, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiSPAS1_MOUSE
AccessioniPrimary (citable) accession number: A2RRY8
Secondary accession number(s): Q6VNB9, Q9CUD9, Q9DAG2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: March 6, 2007
Last modified: November 7, 2018
This is version 64 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again