Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Due to a server migration, the UniProt 'ID mapping', 'Peptide search' and 'community bibliography submission' tools will not be available on the 19th April 2021 during the morning (EST).

UniProtKB - A2RRH5 (WDR27_HUMAN)

Entry version 112 (07 Apr 2021)
Sequence version 3 (05 Apr 2011)
Previous versions | rss
Add a publicationFeedback
Protein

WD repeat-containing protein 27

Gene

WDR27

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		A2RRH5

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		A2RRH5

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
WD repeat-containing protein 27
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:WDR27
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:21248, WDR27

neXtProt; the human protein knowledge platform

More...neXtProti		NX_A2RRH5

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000184465.15

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		253769

Open Targets

More...OpenTargetsi		ENSG00000184465

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134875091

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		A2RRH5, Tdark

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		WDR27

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003068311 – 827WD repeat-containing protein 27Add BLAST827

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		A2RRH5

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		A2RRH5

PeptideAtlas

More...PeptideAtlasi		A2RRH5

PRoteomics IDEntifications database

More...PRIDEi		A2RRH5

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		10146
468 [A2RRH5-1]
469 [A2RRH5-2]
470 [A2RRH5-3]
471 [A2RRH5-4]

Consortium for Top Down Proteomics

More...TopDownProteomicsi		A2RRH5-2 [A2RRH5-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		A2RRH5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		A2RRH5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000184465, Expressed in right uterine tube and 191 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		A2RRH5, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		A2RRH5, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000184465, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		128986, 5 interactors

Protein interaction database and analysis system

More...IntActi		A2RRH5, 2 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000416289

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		A2RRH5, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati3 – 57WD 1Add BLAST55
Repeati62 – 101WD 2Add BLAST40
Repeati112 – 151WD 3Add BLAST40
Repeati155 – 194WD 4Add BLAST40
Repeati201 – 237WD 5Add BLAST37
Repeati292 – 337WD 6Add BLAST46
Repeati344 – 387WD 7Add BLAST44
Repeati502 – 542WD 8Add BLAST41
Repeati546 – 584WD 9Add BLAST39
Repeati590 – 629WD 10Add BLAST40
Repeati646 – 687WD 11Add BLAST42
Repeati698 – 740WD 12Add BLAST43
Repeati746 – 784WD 13Add BLAST39
Repeati788 – 826WD 14Add BLAST39

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0266, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000012017

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_018295_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		A2RRH5

Identification of Orthologs from Complete Genome Data

More...OMAi		AEFCPWQ

Database of Orthologous Groups

More...OrthoDBi		698548at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		A2RRH5

TreeFam database of animal gene trees

More...TreeFami		TF351563

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.130.10.10, 3 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR011047, Quinoprotein_ADH-like_supfam
IPR015943, WD40/YVTN_repeat-like_dom_sf
IPR001680, WD40_repeat
IPR017986, WD40_repeat_dom
IPR042411, WDR27

The PANTHER Classification System

More...PANTHERi		PTHR44525, PTHR44525, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00400, WD40, 5 hits

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00320, WD40, 10 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF50998, SSF50998, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50082, WD_REPEATS_2, 3 hits
PS50294, WD_REPEATS_REGION, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: A2RRH5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MENPQDIFSS NGGCLSDIVI EKYLVESKES VSHVQLACSM QDCAFPLDGT 
        60         70         80         90        100
ELCIWNTKDP SHQLLILRGH HQPITAMAFG NKVNPLLICS ASLDYVIMWN 
       110        120        130        140        150
LDECREKVLQ GLVPRGTVMG SLLGKVLCLQ LSLDDHVVAV CAGNKIFMLD 
       160        170        180        190        200
IETQAVRAEL QGHLGPVTAV EFCPWRAGTL ISASEDRGFK VWDHCTGSLI 
       210        220        230        240        250
YSSSVLSAYP LLSLFIDAES RQLVTGCADG QLWIFSLMDG HHYRRVARVD 
       260        270        280        290        300
LRKKTETFST RRVKSGLCSQ PEESQLPSTS ALGKGEQVEV TFPVLRLAPC 
       310        320        330        340        350
DLSLIPNSAC GCLSSENTRC VWIGSSVGLF VFNLANLEVE AALYYKDFQS 
       360        370        380        390        400
LSILLAGSCA LRNRTADQKV LCLLASLFGG KIAVLEINPA ALVRAQQCPS 
       410        420        430        440        450
MGQSLSVPAS SCVLPTSPLY LGIAKEKSTK AASEQRRAAR NVMKDQRLVF 
       460        470        480        490        500
HSKVRSSGYA SAPHVTMFSP KTNIKSEGKG SSRSRSSCAR EAYPVECAVP 
       510        520        530        540        550
TKPGPQVAAA PTCTRVCCIQ YSGDGQWLAC GLANHLLLVF DASLTGTPAV 
       560        570        580        590        600
FSGHDGAVNA VCWSQDRRWL LSAARDGTLR MWSARGAELA LLLGKDMFSK 
       610        620        630        640        650
PIQSAQFYYI DAFILLSSGP EFQLLRYHID TCKDEIKRYK QKSKSKLICR 
       660        670        680        690        700
LSTTGAVDMT SLSAVNDFYS HIVLAAGRNR TVEVFDLNAG CSAAVIAEAH 
       710        720        730        740        750
SRPVHQICQN KGSSFTTQQP QAYNLFLTTA IGDGMRLWDL RTLRCERHFE 
       760        770        780        790        800
GHPTRGYPCG IAFSPCGRFA ACGAEDRHAY VYEMGSSTFS HRLAGHTDTV 
       810        820 
TGVAFNPSAP QLATATLDGK LQLFLAE
Length:827
Mass (Da):90,038
Last modified:April 5, 2011 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i932404623943AC4C
GO
Isoform 2 (identifier: A2RRH5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     111-207: Missing.

Show »
Length:730
Mass (Da):79,712
Checksum:i58ECDFE7DD65F7DF
GO
Isoform 3 (identifier: A2RRH5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     111-112: GL → GK
     113-827: Missing.

Show »
Length:112
Mass (Da):12,522
Checksum:i6A21DD6CDF3ABB66
GO
Isoform 4 (identifier: A2RRH5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     152-152: E → EQRFSVTYIERPDVNNRHKVPPPTFLHTFSQ
     812-827: LATATLDGKLQLFLAE → MESRSVAHAGVQWHDLGSLQPPPSRFKQFFCLSLPSSWDYSLPQLPWMVNSSSF

Show »
Length:895
Mass (Da):98,096
Checksum:i0D5437DD99F4BD37
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7C3H5H7C3H5_HUMAN
WD repeat-containing protein 27
WDR27
195Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3B3IS64A0A3B3IS64_HUMAN
WD repeat-containing protein 27
WDR27
338Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VUY7F8VUY7_HUMAN
WD repeat-containing protein 27
WDR27
88Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3B3ITF5A0A3B3ITF5_HUMAN
WD repeat-containing protein 27
WDR27
437Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B4DDD4B4DDD4_HUMAN
WD repeat-containing protein 27
WDR27
181Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3B3IT90A0A3B3IT90_HUMAN
WD repeat-containing protein 27
WDR27
177Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3B3IRT0A0A3B3IRT0_HUMAN
WD repeat-containing protein 27
WDR27
128Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3B3ISN9A0A3B3ISN9_HUMAN
WD repeat-containing protein 27
WDR27
163Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti153T → A in BC040606 (PubMed:15489334).Curated1
Sequence conflicti512T → S in AAI31634 (PubMed:15489334).Curated1
Sequence conflicti512T → S in AAI42983 (PubMed:15489334).Curated1
Isoform 4 (identifier: A2RRH5-4)
Sequence conflicti845R → C in BC040606 (PubMed:15489334).Curated1
Sequence conflicti875L → F in BC040606 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_035317133L → P1 PublicationCorresponds to variant dbSNP:rs4236176Ensembl.1
Natural variantiVAR_035318393V → L. Corresponds to variant dbSNP:rs35895089Ensembl.1
Natural variantiVAR_035319437R → H1 PublicationCorresponds to variant dbSNP:rs3800544Ensembl.1
Natural variantiVAR_035320470P → L. Corresponds to variant dbSNP:rs34313252Ensembl.1
Natural variantiVAR_035321697A → V. Corresponds to variant dbSNP:rs9396946Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_028510111 – 207Missing in isoform 2. 1 PublicationAdd BLAST97
Alternative sequenceiVSP_028511111 – 112GL → GK in isoform 3. 1 Publication2
Alternative sequenceiVSP_028512113 – 827Missing in isoform 3. 1 PublicationAdd BLAST715
Alternative sequenceiVSP_040796152E → EQRFSVTYIERPDVNNRHKV PPPTFLHTFSQ in isoform 4. 1 Publication1
Alternative sequenceiVSP_040797812 – 827LATAT…LFLAE → MESRSVAHAGVQWHDLGSLQ PPPSRFKQFFCLSLPSSWDY SLPQLPWMVNSSSF in isoform 4. 1 PublicationAdd BLAST16

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AL031315 Genomic DNA No translation available.
AL135910 Genomic DNA No translation available.
AL441927 Genomic DNA No translation available.
AL513547 Genomic DNA No translation available.
BC040606 mRNA No translation available.
BC131633 mRNA Translation: AAI31634.1
BC142982 mRNA Translation: AAI42983.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS47520.2 [A2RRH5-4]
CCDS56459.1 [A2RRH5-2]

NCBI Reference Sequences

More...RefSeqi		NP_001189479.1, NM_001202550.1 [A2RRH5-2]
NP_872358.4, NM_182552.4 [A2RRH5-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000423258; ENSP00000397869; ENSG00000184465 [A2RRH5-2]
ENST00000448612; ENSP00000416289; ENSG00000184465 [A2RRH5-4]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		253769

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:253769

UCSC genome browser

More...UCSCi		uc003qwx.4, human [A2RRH5-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL031315 Genomic DNA No translation available.
AL135910 Genomic DNA No translation available.
AL441927 Genomic DNA No translation available.
AL513547 Genomic DNA No translation available.
BC040606 mRNA No translation available.
BC131633 mRNA Translation: AAI31634.1
BC142982 mRNA Translation: AAI42983.1
CCDSiCCDS47520.2 [A2RRH5-4]
CCDS56459.1 [A2RRH5-2]
RefSeqiNP_001189479.1, NM_001202550.1 [A2RRH5-2]
NP_872358.4, NM_182552.4 [A2RRH5-4]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi128986, 5 interactors
IntActiA2RRH5, 2 interactors
STRINGi9606.ENSP00000416289

PTM databases

iPTMnetiA2RRH5
PhosphoSitePlusiA2RRH5

Genetic variation databases

BioMutaiWDR27

Proteomic databases

MassIVEiA2RRH5
PaxDbiA2RRH5
PeptideAtlasiA2RRH5
PRIDEiA2RRH5
ProteomicsDBi10146
468 [A2RRH5-1]
469 [A2RRH5-2]
470 [A2RRH5-3]
471 [A2RRH5-4]
TopDownProteomicsiA2RRH5-2 [A2RRH5-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		49469, 98 antibodies

Genome annotation databases

EnsembliENST00000423258; ENSP00000397869; ENSG00000184465 [A2RRH5-2]
ENST00000448612; ENSP00000416289; ENSG00000184465 [A2RRH5-4]
GeneIDi253769
KEGGihsa:253769
UCSCiuc003qwx.4, human [A2RRH5-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		253769
DisGeNETi253769

GeneCards: human genes, protein and diseases

More...GeneCardsi		WDR27
HGNCiHGNC:21248, WDR27
HPAiENSG00000184465, Low tissue specificity
neXtProtiNX_A2RRH5
OpenTargetsiENSG00000184465
PharmGKBiPA134875091
VEuPathDBiHostDB:ENSG00000184465.15

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0266, Eukaryota
GeneTreeiENSGT00390000012017
HOGENOMiCLU_018295_0_0_1
InParanoidiA2RRH5
OMAiAEFCPWQ
OrthoDBi698548at2759
PhylomeDBiA2RRH5
TreeFamiTF351563

Enzyme and pathway databases

PathwayCommonsiA2RRH5
SignaLinkiA2RRH5

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		253769, 2 hits in 1001 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		WDR27, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		253769
PharosiA2RRH5, Tdark

Protein Ontology

More...PROi		PR:A2RRH5
RNActiA2RRH5, protein

Gene expression databases

BgeeiENSG00000184465, Expressed in right uterine tube and 191 other tissues
ExpressionAtlasiA2RRH5, baseline and differential
GenevisibleiA2RRH5, HS

Family and domain databases

Gene3Di2.130.10.10, 3 hits
InterProiView protein in InterPro
IPR011047, Quinoprotein_ADH-like_supfam
IPR015943, WD40/YVTN_repeat-like_dom_sf
IPR001680, WD40_repeat
IPR017986, WD40_repeat_dom
IPR042411, WDR27
PANTHERiPTHR44525, PTHR44525, 1 hit
PfamiView protein in Pfam
PF00400, WD40, 5 hits
SMARTiView protein in SMART
SM00320, WD40, 10 hits
SUPFAMiSSF50998, SSF50998, 1 hit
PROSITEiView protein in PROSITE
PS50082, WD_REPEATS_2, 3 hits
PS50294, WD_REPEATS_REGION, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiWDR27_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A2RRH5
Secondary accession number(s): A5PLM8, C9JGV0, Q5T066
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 2, 2007
Last sequence update: April 5, 2011
Last modified: April 7, 2021
This is version 112 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again