Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

MAX gene-associated protein

Gene

Mga

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Functions as a dual-specificity transcription factor, regulating the expression of both MAX-network and T-box family target genes. Functions as a repressor or an activator. Binds to 5'-AATTTCACACCTAGGTGTGAAATT-3' core sequence and seems to regulate MYC-MAX target genes. Suppresses transcriptional activation by MYC and inhibits MYC-dependent cell transformation. Function activated by heterodimerization with MAX. This heterodimerization serves the dual function of both generating an E-box-binding heterodimer and simultaneously blocking interaction of a corepressor.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi84 – 260T-boxPROSITE-ProRule annotationAdd BLAST177

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding, Repressor
Biological processTranscription, Transcription regulation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-8953750 Transcriptional Regulation by E2F6

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
MAX gene-associated protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Mga
Synonyms:Kiaa4252
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1352483 Mga

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003426931 – 3003MAX gene-associated proteinAdd BLAST3003

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki4Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki178Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki323Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki329Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki348Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki431Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki458Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki463Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki480Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei531PhosphoserineBy similarity1
Cross-linki567Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei604PhosphoserineBy similarity1
Cross-linki610Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki651Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki782Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki788Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki814Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki823Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei848PhosphoserineBy similarity1
Modified residuei921PhosphoserineBy similarity1
Cross-linki925Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki987Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1088Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1136Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1158Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1194Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1202Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei1423PhosphoserineBy similarity1
Modified residuei1450PhosphoserineBy similarity1
Cross-linki1454Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1495Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1937Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki1944Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki2060Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki2084Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki2104Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki2152Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki2179Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei2206Omega-N-methylarginineBy similarity1
Cross-linki2225Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki2317Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki2352Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki2396Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki2471Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei2480PhosphoserineBy similarity1
Cross-linki2568Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki2618Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki2724Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei2849PhosphoserineBy similarity1
Modified residuei2860PhosphoserineBy similarity1
Cross-linki2979Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity

Keywords - PTMi

Isopeptide bond, Methylation, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
A2AWL7

MaxQB - The MaxQuant DataBase

More...
MaxQBi
A2AWL7

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
A2AWL7

PeptideAtlas

More...
PeptideAtlasi
A2AWL7

PRoteomics IDEntifications database

More...
PRIDEi
A2AWL7

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
A2AWL7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
A2AWL7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed at E9.5, E10 and E10.5 in the limb buds, branchial arches and the tail region.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000033943 Expressed in 273 organ(s), highest expression level in pineal body

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
A2AWL7 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
A2AWL7 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of some MLL1/MLL complex, at least composed of the core components KMT2A/MLL1, ASH2L, HCFC1/HCF1, WDR5 and RBBP5, as well as the facultative components BAP18, CHD8, E2F6, HSP70, INO80C, KANSL1, LAS1L, MAX, MCRS1, MGA, MYST1/MOF, PELP1, PHF20, PRP31, RING2, RUVB1/TIP49A, RUVB2/TIP49B, SENP3, TAF1, TAF4, TAF6, TAF7, TAF9 and TEX10. Interacts with ZMYND11 (By similarity). Interacts with MAX. Requires heterodimerization with MAX for E-box binding.By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
205889, 7 interactors

Protein interaction database and analysis system

More...
IntActi
A2AWL7, 6 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000106401

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
A2AWL7

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
A2AWL7

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini2362 – 2413bHLHPROSITE-ProRule annotationAdd BLAST52

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi688 – 691Poly-Thr4
Compositional biasi1634 – 1705Thr-richAdd BLAST72
Compositional biasi1800 – 1847Ser-richAdd BLAST48
Compositional biasi2998 – 3001Poly-Ser4

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Transcription repression is enhanced or dependent on the presence of the T-box DNA-binding domain.

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3585 Eukaryota
ENOG410XSTS LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156269

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG108131

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
A2AWL7

Identification of Orthologs from Complete Genome Data

More...
OMAi
MQEAQEF

Database for complete collections of gene phylogenies

More...
PhylomeDBi
A2AWL7

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00083 HLH, 1 hit
cd00182 TBOX, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.820, 1 hit
4.10.280.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011598 bHLH_dom
IPR032060 DUF4801
IPR036638 HLH_DNA-bd_sf
IPR037935 MAX_gene-associated_protein
IPR008967 p53-like_TF_DNA-bd
IPR036960 T-box_sf
IPR001699 TF_T-box
IPR018186 TF_T-box_CS

The PANTHER Classification System

More...
PANTHERi
PTHR11267 PTHR11267, 2 hits
PTHR11267:SF32 PTHR11267:SF32, 2 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF16059 DUF4801, 1 hit
PF00010 HLH, 1 hit
PF00907 T-box, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00937 TBOX

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00353 HLH, 1 hit
SM00425 TBOX, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47459 SSF47459, 1 hit
SSF49417 SSF49417, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50888 BHLH, 1 hit
PS01264 TBOX_2, 1 hit
PS50252 TBOX_3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: A2AWL7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEEKQQIILA NQDGGTVTGG APTFFVILKQ PGNGKTDQGI LVTNRDARAL
60 70 80 90 100
LSRESSPGKS KEKICLPADC TVGKITVTLD NNSMWNEFHN RSTEMILTKQ
110 120 130 140 150
GRRMFPYCRY WITGLDSNLK YILVMDISPV DSHRYKWNGR WWEPSGKAEP
160 170 180 190 200
HILGRVFIHP ESPSTGHYWM HQPVSFYKLK LTNNTLDQEG HIILHSMHRY
210 220 230 240 250
LPRLHLVPAE KATEVIQLNG PGVHTFTFPQ TEFFAVTAYQ NIQITQLKID
260 270 280 290 300
YNPFAKGFRD DGLSSKPQRE GKQRNSSDQE GNSVSSSPAH RVRLTEGEGS
310 320 330 340 350
EIHSGDFDPV LRGHEASSLS LEKAPHNVKQ DFLGFMNTDS THEVPQLKHE
360 370 380 390 400
ISESRIVNSF EDDSQISSPS NPNGNFNVVI KEEPLDDYDY ELGECPEGIT
410 420 430 440 450
VKQEETDEET DVYSNSDDDP ILEKQLKRHN KVDNLEADHP SYKWLPNSPG
460 470 480 490 500
VAKAKMFKLD AGKMPVVYLE PCAVTKSTVK ISELPDNMLS TSRKDKSMLA
510 520 530 540 550
ELEYLPAYIE NSDGTDFCLS KDSENSLRKH SPDLRIVQKY TLLKEPNWKY
560 570 580 590 600
PDILDNSSTE RIHDSSKGST AESFSGKEDL GKKRTTMLKM AIPSKTVTAS
610 620 630 640 650
HSASPNTPGK RGRPRKLRLS KAGRPPKNTG KSLTAAKNIP VGPGSTFPDV
660 670 680 690 700
KPDLEDVDGV LFVSFESKEA LDIHAVDGTT EEPSSLQTTT TNDSGCRTRI
710 720 730 740 750
SQLEKELIED LKSLRHKQVI HPALQEVGLK LNSVDPTVSI DLKYLGVQLP
760 770 780 790 800
LAPATSFPLW NVTGTNPASP DAGFPFVSRT GKTNDFTKIK GWRGKFQNAS
810 820 830 840 850
ASRNEGGNSE ASLKNRSAFC SDKLDEYLEN EGKLMETNIG FSSNAPTSPV
860 870 880 890 900
VYQLPTKSTS YVRTLDSVLK KQSTISPSTS HSVKPQSVTT ASRKTKAQNK
910 920 930 940 950
QTTLSGRTKS SYKSILPYPV SPKQKNSHVS QGDKITKNSL SSTSDNQVTN
960 970 980 990 1000
LVVPSVDENA FPKQISLRQA QQQHLQQQGT RPPGLSKSQV KLMDLEDCAL
1010 1020 1030 1040 1050
WEGKPRTYIT EERADVSLTT LLTAQASLKT KPIHTIIRKR APPCNNDFCR
1060 1070 1080 1090 1100
LGCVCSSLAL EKRQPAHCRR PDCMFGCTCL KRKVVLVKGG SKTKHFHKKA
1110 1120 1130 1140 1150
ANRDPLFYDT LGEEGREGGG VREDEEQLKE KKKRKKLEYT VCEAEPEQPV
1160 1170 1180 1190 1200
RHYPLWVKVE GEVDPEPVYI PTPSVIEPIK PLVLPQPDLS STTKGKLTPG
1210 1220 1230 1240 1250
IKPARTYTPK PNPVIREEDK DPVYLYFESM MTCARVRVYE RKKEEQRQLS
1260 1270 1280 1290 1300
PPLSPSSSFQ QQSSCYSSPE NRVTKELDSE QTLKQLICDL EDDSDKSQEK
1310 1320 1330 1340 1350
SWKSSCNEGE SSSTSYVHQR SPGGPTKLIE IISDCNWEED RNKILSILSQ
1360 1370 1380 1390 1400
HINSNMPQSL KVGSFIIELA SQRKCRGEKT PPVYSSRVKI SMPSSQDQDD
1410 1420 1430 1440 1450
MAEKSGSETP DGPLSPGKMD DISPVQTDAL DSVRERLHGG KGLPFYAGLS
1460 1470 1480 1490 1500
PSGKLVAYKR KPSSTTSGLI QVASNAKVAA SRKPRTLLPS TSNSKMASSG
1510 1520 1530 1540 1550
PATNRSGKNL KAFVPAKRPI AARPSPGGVF TQFVMSKVGA LQQKIPGVRT
1560 1570 1580 1590 1600
PQPLTGPQKF SIRPSPVMVV TPVVSSEQVQ VCSTVAAAVT TSPQVFLENV
1610 1620 1630 1640 1650
TAVPSLTANS DMGAKEATYS SSASTAGVVE ISETNNTTLV TSTQSTATVN
1660 1670 1680 1690 1700
LTKTTGITTS PVASVSFAKP LVASPTITLP VASTASTSIV MVTTAASSSV
1710 1720 1730 1740 1750
VTTPTSSLSS VPIILSGING SPPVSQRPEN APQIPVTTPQ ISSNNVKRTG
1760 1770 1780 1790 1800
PRLLHPNGQI VQLLPLHQIR GSNAQPSLQP VVFRNPGSMV GIRLPAPCKS
1810 1820 1830 1840 1850
SETPSSSASS SAFSVMSPVI QAVGSSPTVN VISQAPSLLS SGSSFVSQAG
1860 1870 1880 1890 1900
TLTLRISPPE TQNLASKTGS ESKITPSTGG QPVGTASLIP LQSGSFALLQ
1910 1920 1930 1940 1950
LPGQKPIPSS VLQHVASLQI KKESQSTDQK DETNSIKREE ETKKALPSKD
1960 1970 1980 1990 2000
KALDSEANIM KQNSGIIASE NTSNNSLDDG GDLLDEETLR EDARPYEYSY
2010 2020 2030 2040 2050
STGSHTDEDK DGDEDSGNKN QNSPKEKQTV PEVRAGSKNI DIMALQSIRS
2060 2070 2080 2090 2100
IRPQKCVKVK VEPQEGSDNP ENPDDFLVLS KDSKFELSGN QVKEQQSNSQ
2110 2120 2130 2140 2150
AEAKKDCEDS LGKDSLRERW RKHLKGPLTQ KYIGISQNFN KEANVQFFTE
2160 2170 2180 2190 2200
MKPCQENSEQ DISELLGKSG TIESGGVLKT EDGSWSGISS SAAFSIIPRR
2210 2220 2230 2240 2250
ATKGRRGSRH FQGHLLLPRE QMKPKQQTKD GRSSAADFTV LDLEDEDEED
2260 2270 2280 2290 2300
EKTDDSLDEI VDVVSGYQSE EVDVEKNNYV DYLEDDEQVD VETIEELSEE
2310 2320 2330 2340 2350
INFPYKKTTA THTQSFKQQC HSHISADEKA SEKSRKVSLI SSKLKDDCWG
2360 2370 2380 2390 2400
DKPHKETEAF AYYRRTHTAN ERRRRGEMRD LFEKLKITLG LLHSSKVSKS
2410 2420 2430 2440 2450
LILNRAFSEI QGLTDQADKL IGQKNLLSRK RSILIRKVSS LSGKTEEVVL
2460 2470 2480 2490 2500
KKLEYIYAKQ QALEAQKRKK KLGSDEFCVS PRIGTQLEGS SASSVDLGQM
2510 2520 2530 2540 2550
LMNNRRGKPL ILSRKRDQAT ENASPSDTPH SSANLVMTPQ GQLLTLKGPL
2560 2570 2580 2590 2600
FSGPVVAVSP ALLEGGLKPQ VASSTMSQSE NDDLFMMPRI VNVTSLAAEE
2610 2620 2630 2640 2650
DLGGMSGNKY RHEVPDGKPL DHLRDIAGSE ASSLKDTERI SSRGNHRDSR
2660 2670 2680 2690 2700
KALGPTQVLL ANKDSGFPHV ADVSTMQAAQ EFIPKNMSGD VRGHRYKWKE
2710 2720 2730 2740 2750
CELRGERLKS KESQFHKLKM KDLKDSSIEM ELRKVASAIE EAALHPSELL
2760 2770 2780 2790 2800
TNMEDEDDTD ETLTSLLNEI AFLNQQLNDD SGLAELSGSM DTEFSGDAQR
2810 2820 2830 2840 2850
AFISKLAPGN RSAFQVGHLG AGVKELPDVQ EESESISPLL LHLEDDDFSE
2860 2870 2880 2890 2900
NEKQLGDTAS EPDVLKIVID PEIKDSLVSH RKSSDGGQST SGLPAEPESV
2910 2920 2930 2940 2950
SSPPILHMKT GPENSNTDTL WRPMPKLAPL GLKVANPPSD ADGQSLKVMP
2960 2970 2980 2990 3000
ALAPIAAKVG SIGHKMNLAG IDQEGRGSKV MPTLAPVVPK LGNSGAPSSS

SGK
Length:3,003
Mass (Da):328,802
Last modified:February 20, 2007 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC0963FF86506A75C
GO
Isoform 2 (identifier: A2AWL7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1214-1214: Missing.
     1521-1728: Missing.
     1754-1754: L → LLIPVQQGSPTLRPIQNPQLQGQRMVLQPVRGPSGMNLFR
     2466-3003: Missing.

Note: No experimental confirmation available.
Show »
Length:2,295
Mass (Da):254,418
Checksum:i844E7A68DC01D030
GO
Isoform 3 (identifier: A2AWL7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     727-805: Missing.

Note: No experimental confirmation available.
Show »
Length:2,924
Mass (Da):320,326
Checksum:i8791B93D795EDAC1
GO
Isoform 4 (identifier: A2AWL7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     669-671: EAL → VWL
     672-3003: Missing.

Note: No experimental confirmation available.
Show »
Length:671
Mass (Da):75,270
Checksum:i26ACF8D2B46E46D1
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9QLG3E9QLG3_MOUSE
MAX gene-associated protein
Mga
3,042Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7BX50H7BX50_MOUSE
MAX gene-associated protein
Mga
2,833Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAD32240 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti11N → T in AAF24761 (PubMed:10601024).Curated1
Sequence conflicti195H → Y in BAC27930 (PubMed:16141072).Curated1
Sequence conflicti217Q → P in AAF24761 (PubMed:10601024).Curated1
Sequence conflicti342H → P in AAF24761 (PubMed:10601024).Curated1
Sequence conflicti346Q → P in AAF24761 (PubMed:10601024).Curated1
Sequence conflicti349H → P in AAF24761 (PubMed:10601024).Curated1
Sequence conflicti359S → R in AAF24761 (PubMed:10601024).Curated1
Sequence conflicti403Q → P in AAF24761 (PubMed:10601024).Curated1
Sequence conflicti458K → R in BAC32658 (PubMed:16141072).Curated1
Sequence conflicti634T → P in AAF24761 (PubMed:10601024).Curated1
Sequence conflicti666E → D in AAF24761 (PubMed:10601024).Curated1
Sequence conflicti752A → G in AAF24761 (PubMed:10601024).Curated1
Sequence conflicti757F → L in AAF24761 (PubMed:10601024).Curated1
Sequence conflicti844N → D in AAF24761 (PubMed:10601024).Curated1
Sequence conflicti873S → C in AAF24761 (PubMed:10601024).Curated1
Sequence conflicti903T → A in AAF24761 (PubMed:10601024).Curated1
Sequence conflicti1061E → D in AAF24761 (PubMed:10601024).Curated1
Sequence conflicti1136K → E in BAD32240 (PubMed:15368895).Curated1
Sequence conflicti1191S → ST in AAF24761 (PubMed:10601024).Curated1
Sequence conflicti1593P → L in AAF24761 (PubMed:10601024).Curated1
Sequence conflicti1753 – 1755LLH → FDVG in AAF24761 (PubMed:10601024).Curated3
Sequence conflicti1763L → F in AAF24761 (PubMed:10601024).Curated1
Sequence conflicti1826S → P in AAF24761 (PubMed:10601024).Curated1
Sequence conflicti1845F → L in AAF24761 (PubMed:10601024).Curated1
Sequence conflicti2033V → A in AAF24761 (PubMed:10601024).Curated1
Sequence conflicti2043M → I in AAF24761 (PubMed:10601024).Curated1
Sequence conflicti2478C → G in AAF24761 (PubMed:10601024).Curated1
Sequence conflicti2800 – 2802RAF → ARLI in AAF24761 (PubMed:10601024).Curated3
Sequence conflicti2809G → V in AAF24761 (PubMed:10601024).Curated1
Sequence conflicti2814F → Y in AAF24761 (PubMed:10601024).Curated1
Sequence conflicti2819 – 2821LGA → MGT in AAF24761 (PubMed:10601024).Curated3
Sequence conflicti2830Q → L in AAF24761 (PubMed:10601024).Curated1
Sequence conflicti2835S → T in AAF24761 (PubMed:10601024).Curated1
Sequence conflicti2852 – 2853EK → VR in AAF24761 (PubMed:10601024).Curated2
Sequence conflicti2865L → H in AAF24761 (PubMed:10601024).Curated1
Sequence conflicti2877L → R in AAF24761 (PubMed:10601024).Curated1
Sequence conflicti2928A → T in AAF24761 (PubMed:10601024).Curated1
Sequence conflicti2969A → T in AAF24761 (PubMed:10601024).Curated1
Sequence conflicti2971I → S in AAF24761 (PubMed:10601024).Curated1
Sequence conflicti2998S → L in AAF24761 (PubMed:10601024).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_034536669 – 671EAL → VWL in isoform 4. 1 Publication3
Alternative sequenceiVSP_034537672 – 3003Missing in isoform 4. 1 PublicationAdd BLAST2332
Alternative sequenceiVSP_034538727 – 805Missing in isoform 3. 1 PublicationAdd BLAST79
Alternative sequenceiVSP_0345391214Missing in isoform 2. 1 Publication1
Alternative sequenceiVSP_0345401521 – 1728Missing in isoform 2. 1 PublicationAdd BLAST208
Alternative sequenceiVSP_0345411754L → LLIPVQQGSPTLRPIQNPQL QGQRMVLQPVRGPSGMNLFR in isoform 2. 1 Publication1
Alternative sequenceiVSP_0345422466 – 3003Missing in isoform 2. 1 PublicationAdd BLAST538

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF205935 mRNA Translation: AAF24761.1
AK032570 mRNA Translation: BAC27930.1
AK046252 mRNA Translation: BAC32658.1
AK133775 mRNA Translation: BAE21832.1
AK162302 mRNA Translation: BAE36840.1
AL954662 Genomic DNA No translation available.
AK172962 mRNA Translation: BAD32240.1 Different initiation.

NCBI Reference Sequences

More...
RefSeqi
NP_038748.2, NM_013720.2

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Mm.437053
Mm.87532

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000046717; ENSMUSP00000043795; ENSMUSG00000033943 [A2AWL7-1]
ENSMUST00000110773; ENSMUSP00000106400; ENSMUSG00000033943 [A2AWL7-3]
ENSMUST00000156510; ENSMUSP00000119044; ENSMUSG00000033943 [A2AWL7-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
29808

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:29808

UCSC genome browser

More...
UCSCi
uc008lur.1 mouse [A2AWL7-4]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF205935 mRNA Translation: AAF24761.1
AK032570 mRNA Translation: BAC27930.1
AK046252 mRNA Translation: BAC32658.1
AK133775 mRNA Translation: BAE21832.1
AK162302 mRNA Translation: BAE36840.1
AL954662 Genomic DNA No translation available.
AK172962 mRNA Translation: BAD32240.1 Different initiation.
RefSeqiNP_038748.2, NM_013720.2
UniGeneiMm.437053
Mm.87532

3D structure databases

ProteinModelPortaliA2AWL7
SMRiA2AWL7
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi205889, 7 interactors
IntActiA2AWL7, 6 interactors
STRINGi10090.ENSMUSP00000106401

PTM databases

iPTMnetiA2AWL7
PhosphoSitePlusiA2AWL7

Proteomic databases

EPDiA2AWL7
MaxQBiA2AWL7
PaxDbiA2AWL7
PeptideAtlasiA2AWL7
PRIDEiA2AWL7

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000046717; ENSMUSP00000043795; ENSMUSG00000033943 [A2AWL7-1]
ENSMUST00000110773; ENSMUSP00000106400; ENSMUSG00000033943 [A2AWL7-3]
ENSMUST00000156510; ENSMUSP00000119044; ENSMUSG00000033943 [A2AWL7-2]
GeneIDi29808
KEGGimmu:29808
UCSCiuc008lur.1 mouse [A2AWL7-4]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23269
MGIiMGI:1352483 Mga

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiKOG3585 Eukaryota
ENOG410XSTS LUCA
GeneTreeiENSGT00940000156269
HOVERGENiHBG108131
InParanoidiA2AWL7
OMAiMQEAQEF
PhylomeDBiA2AWL7

Enzyme and pathway databases

ReactomeiR-MMU-8953750 Transcriptional Regulation by E2F6

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Mga mouse

Protein Ontology

More...
PROi
PR:A2AWL7

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000033943 Expressed in 273 organ(s), highest expression level in pineal body
ExpressionAtlasiA2AWL7 baseline and differential
GenevisibleiA2AWL7 MM

Family and domain databases

CDDicd00083 HLH, 1 hit
cd00182 TBOX, 1 hit
Gene3Di2.60.40.820, 1 hit
4.10.280.10, 1 hit
InterProiView protein in InterPro
IPR011598 bHLH_dom
IPR032060 DUF4801
IPR036638 HLH_DNA-bd_sf
IPR037935 MAX_gene-associated_protein
IPR008967 p53-like_TF_DNA-bd
IPR036960 T-box_sf
IPR001699 TF_T-box
IPR018186 TF_T-box_CS
PANTHERiPTHR11267 PTHR11267, 2 hits
PTHR11267:SF32 PTHR11267:SF32, 2 hits
PfamiView protein in Pfam
PF16059 DUF4801, 1 hit
PF00010 HLH, 1 hit
PF00907 T-box, 1 hit
PRINTSiPR00937 TBOX
SMARTiView protein in SMART
SM00353 HLH, 1 hit
SM00425 TBOX, 1 hit
SUPFAMiSSF47459 SSF47459, 1 hit
SSF49417 SSF49417, 1 hit
PROSITEiView protein in PROSITE
PS50888 BHLH, 1 hit
PS01264 TBOX_2, 1 hit
PS50252 TBOX_3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMGAP_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A2AWL7
Secondary accession number(s): A2AWL6
, Q3TS36, Q6A056, Q8BQX1, Q8CCL4, Q9QXJ5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 1, 2008
Last sequence update: February 20, 2007
Last modified: December 5, 2018
This is version 103 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again