Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 106 (08 May 2019)
Sequence version 1 (20 Feb 2007)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1

Gene

Ppip5k1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Bifunctional inositol kinase that acts in concert with the IP6K kinases IP6K1, IP6K2 and IP6K3 to synthesize the diphosphate group-containing inositol pyrophosphates diphosphoinositol pentakisphosphate, PP-InsP5, and bis-diphosphoinositol tetrakisphosphate, (PP)2-InsP4. PP-InsP5 and (PP)2-InsP4, also respectively called InsP7 and InsP8, regulate a variety of cellular processes, including apoptosis, vesicle trafficking, cytoskeletal dynamics, exocytosis, insulin signaling and neutrophil activation. Phosphorylates inositol hexakisphosphate (InsP6) at positions 1 or 3 to produce PP-InsP5 which is in turn phosphorylated by IP6Ks to produce (PP)2-InsP4. Alternatively, phosphorylates at position 1 or 3 PP-InsP5, produced by IP6Ks from InsP6, to produce (PP)2-InsP4. Activated when cells are exposed to hyperosmotic stress.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei145ATPBy similarity1
Binding sitei198ATPBy similarity1
Binding sitei205ATPBy similarity1
Binding sitei224ATPBy similarity1
Binding sitei259SubstrateBy similarity1
Binding sitei273SubstrateBy similarity1
Binding sitei275ATPBy similarity1
Binding sitei320ATPBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi248 – 251ATPBy similarity4
Nucleotide bindingi257 – 259ATPBy similarity3
Nucleotide bindingi332 – 334ATPBy similarity3

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionKinase, Transferase
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-1855167 Synthesis of pyrophosphates in the cytosol

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 (EC:2.7.4.21, EC:2.7.4.24)
Alternative name(s):
Diphosphoinositol pentakisphosphate kinase 1
Histidine acid phosphatase domain-containing protein 2A
InsP6 and PP-IP5 kinase 1
VIP1 homolog
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Ppip5k1
Synonyms:Hisppd2a, Kiaa0377, Vip1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2443281 Ppip5k1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003156891 – 1436Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1Add BLAST1436

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei939PhosphoserineBy similarity1
Modified residuei982PhosphoserineBy similarity1
Modified residuei1032PhosphoserineBy similarity1
Modified residuei1068PhosphoserineBy similarity1
Modified residuei1140PhosphoserineCombined sources1
Modified residuei1147PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQB - The MaxQuant DataBase

More...
MaxQBi
A2ARP1

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
A2ARP1

PeptideAtlas

More...
PeptideAtlasi
A2ARP1

PRoteomics IDEntifications database

More...
PRIDEi
A2ARP1

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
A2ARP1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
A2ARP1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000033526 Expressed in 234 organ(s), highest expression level in quadriceps femoris

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
A2ARP1 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
A2ARP1 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000106256

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
A2ARP1

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni64 – 65Substrate bindingBy similarity2
Regioni224 – 225Substrate bindingBy similarity2
Regioni337 – 340Substrate bindingBy similarity4
Regioni382 – 453Polyphosphoinositide-binding domainBy similarityAdd BLAST72

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The C-terminal acid phosphatase-like domain binds PtdIns(3,4,5)P3 and InsP6. Despite its similarity with the phosphatase domain of histidine acid phosphatases, it has no phosphatase activity.By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1057 Eukaryota
ENOG410XNSN LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000009048

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
A2ARP1

KEGG Orthology (KO)

More...
KOi
K13024

Identification of Orthologs from Complete Genome Data

More...
OMAi
YITVVIM

Database of Orthologous Groups

More...
OrthoDBi
93740at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
A2ARP1

TreeFam database of animal gene trees

More...
TreeFami
TF313594

Family and domain databases

Conserved Domains Database

More...
CDDi
cd07061 HP_HAP_like, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR033379 Acid_Pase_AS
IPR000560 His_Pase_clade-2
IPR037446 His_Pase_VIP1
IPR029033 His_PPase_superfam
IPR040557 VIP1_N

The PANTHER Classification System

More...
PANTHERi
PTHR12750 PTHR12750, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00328 His_Phos_2, 1 hit
PF18086 PPIP5K2_N, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF53254 SSF53254, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00616 HIS_ACID_PHOSPHAT_1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: A2ARP1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MWSLTANEDE STTAHFFLGA GDEGLGTCGI GMRTEESDSE LLEDEEDEVP
60 70 80 90 100
PEPQIIVGIC AMTKKSKSKP MTQILERLCR FDYLTVVILG EDVILNEPVE
110 120 130 140 150
NWPSCHCLIS FHSKGFPLDK AVAYSKLRNP FLINDLAMQY YIQDRREVYR
160 170 180 190 200
ILQEEGIDLP RYAVLNRDPA CPEECSLIEG EDQVEVNGAV FPKPFVEKPV
210 220 230 240 250
SAEDHNVYIY YPSSAGGGSQ RLFRKIGSRS SVYSPESSVR KTGSYIYEEF
260 270 280 290 300
MPTDGTDVKV YTVGPDYAHA EARKSPALDG KVERDSEGKE VRYPVMLTAM
310 320 330 340 350
EKLVARKVCV AFKQTVCGFD LLRANGHSFV CDVNGFSFVK NSMKYYDDCA
360 370 380 390 400
KILGNTIMRE LAPQFQIPWS IPTEAEDIPI VPTTSGTMME LRCVIAIIRH
410 420 430 440 450
GDRTPKQKMK MEVTHPRFFA LFEKHGGYKT GKLKLKRPEQ LQEVLDITRL
460 470 480 490 500
LLAELEKEPE AEIEEKTGKL EQLKSVLEMY GHFSGINRKV QLTYYPHGVK
510 520 530 540 550
ASNEGQDLQR EPLAPSLLLV LKWGGELTPD GRVQAEELGR AFRCMYPGGQ
560 570 580 590 600
GDYAGFPGCG LLRLHSTFRH DLKIYASDEG RVQMTAAAFA KGLLALEGEL
610 620 630 640 650
TPILVQMVKS ANMNGLLDSD SDSLSSCQHR VKARLHHILQ QDAPFGPEDY
660 670 680 690 700
DQLAPTGSTS LLNSMSVIQN PVKVCDQVFA LIENLTHQIR ERMQDPSSVD
710 720 730 740 750
LQLYHSETLE LMLQRWSKLE RDFRQKSGRY DISKIPDIYD CVKYDVQHNG
760 770 780 790 800
SLGLQGTAEL LRLSKALADV VIPQEYGISR EEKVEIAVGF CLPLLRKILL
810 820 830 840 850
DLQRTHEDES VNKLHPLYSR GVLSPGRHVR TRLYFTSESH VHSLLSVFRY
860 870 880 890 900
GGLLDETQDA QWQRALAYLS AISELNYMTQ IVIMLYEDNT RDPLSEERFH
910 920 930 940 950
VELHFSPGVK GVEEGSAPAG CGFRPASSEN EEMKTDPGSI ENLCPGKASD
960 970 980 990 1000
EPDRALQTSP QPVEGTGLPR RSPLIRNRKA GSMEVLSETS SSRPGGYRLF
1010 1020 1030 1040 1050
SSSRPPTEMK QSGLGSQCTG LFSTTVLGGS SSAPNLQDYA RTHGKKLPPA
1060 1070 1080 1090 1100
SLKHRDELLF VPAVKRFSVS FAKHPTNGFE GCSMVPTIYP LETLHNALSL
1110 1120 1130 1140 1150
RQVSEFLTKV CQRHTDAHAQ ASAALFDSMH NHQASDSPFS PPRTLHSPPL
1160 1170 1180 1190 1200
QLRHRSEKPP WYSSGPSSTV SSAGPSSPTT VDGNSHFGFS DQSSVNIHMT
1210 1220 1230 1240 1250
EEKQGFGLLQ ETPGDGTREL HIERQQELVE PAQSPQELPV EICPSGSQGV
1260 1270 1280 1290 1300
TKVSQTCQEV PDIVQPCHNI HEEIGQPQQE VPDISQLLLK DHDTTTNTCH
1310 1320 1330 1340 1350
LCQASQLSQK VCEEICQLCQ DNHEESNQLC QEVSVKLGRM VHGFPVNVDS
1360 1370 1380 1390 1400
TAQETLMEIG RPTQEIPEDP YQEFSVKVGV LAQKAPAISE LSQDIPEADK
1410 1420 1430
PSQELSEETE LQAQEVSEEI DQESEVVDEL PPEAIS
Length:1,436
Mass (Da):159,923
Last modified:February 20, 2007 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD160DDDA7F34B4F2
GO
Isoform 2 (identifier: A2ARP1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     818-837: Missing.

Note: No experimental confirmation available.
Show »
Length:1,416
Mass (Da):157,588
Checksum:i39D0CF8B9C48BF98
GO
Isoform 3 (identifier: A2ARP1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1057-1077: Missing.

Note: No experimental confirmation available.
Show »
Length:1,415
Mass (Da):157,553
Checksum:iF51E050A638DA33A
GO
Isoform 4 (identifier: A2ARP1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     261-266: YTVGPD → MVDAEI
     267-1436: Missing.

Note: No experimental confirmation available.
Show »
Length:266
Mass (Da):29,888
Checksum:i3058794BBECC2253
GO
Isoform 5 (identifier: A2ARP1-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     403-439: RTPKQKMKMEVTHPRFFALFEKHGGYKTGKLKLKRPE → HPSFVIEKLVPWRCCLKLHLQDLVATVCFHLHGHQQR
     440-1436: Missing.

Note: No experimental confirmation available.
Show »
Length:439
Mass (Da):49,416
Checksum:i5886DD464B506F60
GO
Isoform 6 (identifier: A2ARP1-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     653-671: LAPTGSTSLLNSMSVIQNP → VTLFSSPCSNYIATQFLKF
     672-1436: Missing.

Note: No experimental confirmation available.
Show »
Length:671
Mass (Da):75,262
Checksum:iDDF3D544D053FE04
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F7AST3F7AST3_MOUSE
Inositol hexakisphosphate and dipho...
Ppip5k1
271Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6Q5C6F6Q5C6_MOUSE
Inositol hexakisphosphate and dipho...
Ppip5k1
257Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B0R0E7B0R0E7_MOUSE
Inositol hexakisphosphate and dipho...
Ppip5k1
49Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6VU93F6VU93_MOUSE
Inositol hexakisphosphate and dipho...
Ppip5k1
118Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6RMX0F6RMX0_MOUSE
Inositol hexakisphosphate and dipho...
Ppip5k1
198Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6VID9F6VID9_MOUSE
Inositol hexakisphosphate and dipho...
Ppip5k1
283Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC32838 differs from that shown. Intron retention.Curated
The sequence BAC37198 differs from that shown. Reason: Frameshift at position 42.Curated
The sequence BAC65546 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti441L → I in BAC38780 (PubMed:16141072).Curated1
Sequence conflicti831T → A in BAC32838 (PubMed:16141072).Curated1
Sequence conflicti1049P → S in BAC65546 (PubMed:12693553).Curated1
Sequence conflicti1180T → A in AAP46293 (Ref. 1) Curated1
Sequence conflicti1180T → A in BAC65546 (PubMed:12693553).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_030625261 – 266YTVGPD → MVDAEI in isoform 4. 1 Publication6
Alternative sequenceiVSP_030626267 – 1436Missing in isoform 4. 1 PublicationAdd BLAST1170
Alternative sequenceiVSP_030627403 – 439RTPKQ…LKRPE → HPSFVIEKLVPWRCCLKLHL QDLVATVCFHLHGHQQR in isoform 5. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_030628440 – 1436Missing in isoform 5. 1 PublicationAdd BLAST997
Alternative sequenceiVSP_030629653 – 671LAPTG…VIQNP → VTLFSSPCSNYIATQFLKF in isoform 6. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_030630672 – 1436Missing in isoform 6. 1 PublicationAdd BLAST765
Alternative sequenceiVSP_030631818 – 837Missing in isoform 2. CuratedAdd BLAST20
Alternative sequenceiVSP_0306341057 – 1077Missing in isoform 3. CuratedAdd BLAST21

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF502585 mRNA Translation: AAP46293.1
AK122264 mRNA Translation: BAC65546.1 Different initiation.
AK046696 mRNA Translation: BAC32838.1 Sequence problems.
AK078268 mRNA Translation: BAC37198.1 Frameshift.
AK083140 mRNA Translation: BAC38780.1
AL845466 Genomic DNA No translation available.
BC065138 mRNA Translation: AAH65138.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS16639.1 [A2ARP1-1]

NCBI Reference Sequences

More...
RefSeqi
NP_848910.3, NM_178795.4 [A2ARP1-1]
XP_006499804.1, XM_006499741.3 [A2ARP1-1]
XP_011237919.1, XM_011239617.2 [A2ARP1-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000052029; ENSMUSP00000057632; ENSMUSG00000033526 [A2ARP1-1]
ENSMUST00000110625; ENSMUSP00000106255; ENSMUSG00000033526 [A2ARP1-3]
ENSMUST00000110626; ENSMUSP00000106256; ENSMUSG00000033526 [A2ARP1-1]
ENSMUST00000110627; ENSMUSP00000106257; ENSMUSG00000033526 [A2ARP1-3]
ENSMUST00000110628; ENSMUSP00000106258; ENSMUSG00000033526 [A2ARP1-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
327655

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:327655

UCSC genome browser

More...
UCSCi
uc008lyl.1 mouse [A2ARP1-1]
uc008lyq.1 mouse [A2ARP1-7]
uc008lyr.1 mouse [A2ARP1-5]
uc008lys.1 mouse [A2ARP1-6]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF502585 mRNA Translation: AAP46293.1
AK122264 mRNA Translation: BAC65546.1 Different initiation.
AK046696 mRNA Translation: BAC32838.1 Sequence problems.
AK078268 mRNA Translation: BAC37198.1 Frameshift.
AK083140 mRNA Translation: BAC38780.1
AL845466 Genomic DNA No translation available.
BC065138 mRNA Translation: AAH65138.1
CCDSiCCDS16639.1 [A2ARP1-1]
RefSeqiNP_848910.3, NM_178795.4 [A2ARP1-1]
XP_006499804.1, XM_006499741.3 [A2ARP1-1]
XP_011237919.1, XM_011239617.2 [A2ARP1-3]

3D structure databases

SMRiA2ARP1
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000106256

PTM databases

iPTMnetiA2ARP1
PhosphoSitePlusiA2ARP1

Proteomic databases

MaxQBiA2ARP1
PaxDbiA2ARP1
PeptideAtlasiA2ARP1
PRIDEiA2ARP1

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000052029; ENSMUSP00000057632; ENSMUSG00000033526 [A2ARP1-1]
ENSMUST00000110625; ENSMUSP00000106255; ENSMUSG00000033526 [A2ARP1-3]
ENSMUST00000110626; ENSMUSP00000106256; ENSMUSG00000033526 [A2ARP1-1]
ENSMUST00000110627; ENSMUSP00000106257; ENSMUSG00000033526 [A2ARP1-3]
ENSMUST00000110628; ENSMUSP00000106258; ENSMUSG00000033526 [A2ARP1-2]
GeneIDi327655
KEGGimmu:327655
UCSCiuc008lyl.1 mouse [A2ARP1-1]
uc008lyq.1 mouse [A2ARP1-7]
uc008lyr.1 mouse [A2ARP1-5]
uc008lys.1 mouse [A2ARP1-6]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9677
MGIiMGI:2443281 Ppip5k1

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiKOG1057 Eukaryota
ENOG410XNSN LUCA
GeneTreeiENSGT00390000009048
InParanoidiA2ARP1
KOiK13024
OMAiYITVVIM
OrthoDBi93740at2759
PhylomeDBiA2ARP1
TreeFamiTF313594

Enzyme and pathway databases

ReactomeiR-MMU-1855167 Synthesis of pyrophosphates in the cytosol

Miscellaneous databases

Protein Ontology

More...
PROi
PR:A2ARP1

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000033526 Expressed in 234 organ(s), highest expression level in quadriceps femoris
ExpressionAtlasiA2ARP1 baseline and differential
GenevisibleiA2ARP1 MM

Family and domain databases

CDDicd07061 HP_HAP_like, 1 hit
InterProiView protein in InterPro
IPR033379 Acid_Pase_AS
IPR000560 His_Pase_clade-2
IPR037446 His_Pase_VIP1
IPR029033 His_PPase_superfam
IPR040557 VIP1_N
PANTHERiPTHR12750 PTHR12750, 1 hit
PfamiView protein in Pfam
PF00328 His_Phos_2, 1 hit
PF18086 PPIP5K2_N, 1 hit
SUPFAMiSSF53254 SSF53254, 1 hit
PROSITEiView protein in PROSITE
PS00616 HIS_ACID_PHOSPHAT_1, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiVIP1_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A2ARP1
Secondary accession number(s): A2ARP2
, A2ARP3, A2ARP4, Q6P1C8, Q7TSP1, Q80U21, Q8BL16, Q8BUN6, Q8BVG9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: February 20, 2007
Last modified: May 8, 2019
This is version 106 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again