Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Formin-like protein 2

Gene

Fmnl2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the cortical actin filament dynamics (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

ReactomeiR-MMU-5663220 RHO GTPases Activate Formins

Names & Taxonomyi

Protein namesi
Recommended name:
Formin-like protein 2
Alternative name(s):
Protein Man
Gene namesi
Name:Fmnl2
Synonyms:Kiaa1902, Man
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 2

Organism-specific databases

MGIiMGI:1918659 Fmnl2

Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemoved
ChainiPRO_00002890942 – 1086Formin-like protein 2Add BLAST1085

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Lipidationi2N-myristoyl glycineBy similarity1
Modified residuei188PhosphoserineBy similarity1

Keywords - PTMi

Lipoprotein, Myristate, Phosphoprotein

Proteomic databases

MaxQBiA2APV2
PaxDbiA2APV2
PeptideAtlasiA2APV2
PRIDEiA2APV2

PTM databases

iPTMnetiA2APV2
PhosphoSitePlusiA2APV2
SwissPalmiA2APV2

Expressioni

Gene expression databases

BgeeiENSMUSG00000036053 Expressed in 236 organ(s), highest expression level in blastocyst
CleanExiMM_FMNL2
ExpressionAtlasiA2APV2 baseline and differential
GenevisibleiA2APV2 MM

Interactioni

GO - Molecular functioni

Protein-protein interaction databases

BioGridi214689, 1 interactor
IntActiA2APV2, 1 interactor
STRINGi10090.ENSMUSP00000047260

Structurei

3D structure databases

ProteinModelPortaliA2APV2
SMRiA2APV2
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini23 – 469GBD/FH3PROSITE-ProRule annotationAdd BLAST447
Domaini615 – 1006FH2PROSITE-ProRule annotationAdd BLAST392
Domaini1038 – 1077DADAdd BLAST40

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi525 – 602Pro-richAdd BLAST78

Domaini

The DAD domain regulates activation via by an autoinhibitory interaction with the GBD/FH3 domain. This autoinhibition is released upon competitive binding of an activated GTPase. The release of DAD allows the FH2 domain to then nucleate and elongate nonbranched actin filaments (By similarity).By similarity

Sequence similaritiesi

Belongs to the formin homology family.Curated

Phylogenomic databases

eggNOGiKOG1923 Eukaryota
ENOG410Y3DT LUCA
GeneTreeiENSGT00760000118986
HOGENOMiHOG000231209
HOVERGENiHBG053118
InParanoidiA2APV2
OMAiMMPGFSP
OrthoDBiEOG091G01GP
PhylomeDBiA2APV2
TreeFamiTF325155

Family and domain databases

InterProiView protein in InterPro
IPR016024 ARM-type_fold
IPR015425 FH2_Formin
IPR010472 FH3_dom
IPR027656 FMNL2
IPR014768 GBD/FH3_dom
IPR010473 GTPase-bd
PANTHERiPTHR23213:SF180 PTHR23213:SF180, 1 hit
PfamiView protein in Pfam
PF06367 Drf_FH3, 1 hit
PF06371 Drf_GBD, 2 hits
PF02181 FH2, 1 hit
SMARTiView protein in SMART
SM01139 Drf_FH3, 1 hit
SM01140 Drf_GBD, 1 hit
SM00498 FH2, 1 hit
SUPFAMiSSF48371 SSF48371, 2 hits
PROSITEiView protein in PROSITE
PS51444 FH2, 1 hit
PS51232 GBD_FH3, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: A2APV2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGNAGSMDSQ QTDFKAHNVP LKLPMPEPGE LEERFAIVLN AMNLPPDKAR
60 70 80 90 100
LLRQYDNEKK WELICDQERF QVKNPPHTYI QKLKGYLDPA VTRKKFRRRV
110 120 130 140 150
QESTQVLREL EISLRTNHIG WVREFLNEEN KGLDVLVEYL SFAQYAVTFD
160 170 180 190 200
FESVESTMES TVDKSKPWSR SIEDLHRGSN LPSPVGNSVS RSGRHSALRY
210 220 230 240 250
NTLPSRRTLK NSRLVSKKDD VHVCIMCLRA IMNYQYGFNM VMSHPHAVNE
260 270 280 290 300
IALSLNNKNP RTKALVLELL AAVCLVRGGH EIILSAFDNF KEVCGEKQRF
310 320 330 340 350
EKLMEHFRNE DNNIDFMVAS MQFINIVVHS VEDMNFRVHL QYEFTKLGLD
360 370 380 390 400
EYLDKLKHTE SDKLQVQIQA YLDNVFDVGA LLEDAETKNA ALERVEELEE
410 420 430 440 450
NISHLSEKLQ DTENEAMSKI VELEKQLMQR NKELDVVREI YKDANTQVHT
460 470 480 490 500
LRKMVKEKEE AIQRQSTLEK KIHELEKQGT IKIQKKGDGD IAILPVMASG
510 520 530 540 550
TLSTGSELAV GNYVGSVPGA TTSGPSVPPP PPLPPSSDTS EAAQNGTASP
560 570 580 590 600
PMSPPPPPPP PPPPPPPPPP PLPGPAAETS PAPPLPPPPP PSAPPLPGTS
610 620 630 640 650
SPTVVFNSGL AAVKIKKPIK TKFRMPVFNW VALKPNQING TVFNEIDDER
660 670 680 690 700
ILEDLNVDEF EEIFKTKAQG PAIDLSSSKQ KITQKASSKV TLLEANRAKN
710 720 730 740 750
LAITLRKAGK SADEICKAIH VFDLKTLPVD FVECLMRFLP TENEVKVLRL
760 770 780 790 800
YERERKPLEN LSDEDRFMMQ FSKIERLLQK MTIMAFIGNF TESIQMLTPQ
810 820 830 840 850
LHAIIAASVS IKSSQKLKKI LEIILALGNY MNSSKRGAVY GFKLQSLDLL
860 870 880 890 900
LDTKSTDRKQ TLLHYISNVV KEKYQQVTLF YNELHYVEKA AAVSLENVLL
910 920 930 940 950
DVKELQRGMD LTKREYTMHD HNTLLKEFLL HNEGKLKKLQ EDAKIAQDAF
960 970 980 990 1000
DDVVKYFGEN PKTTPPSVFF PVFVRFVKAY KQAEEENELR KKQEQALMEK
1010 1020 1030 1040 1050
LLEQEALMEQ QDAKSPSHKS KRQQQELIAE LRRRQVKDNR HVYEGKDGAI
1060 1070 1080
EDIITALKKN NITKFPNVHS RVRISSSTPV VEDTQS
Length:1,086
Mass (Da):123,101
Last modified:May 29, 2007 - v2
Checksum:i0E5BBC192FCF8ACA
GO
Isoform 2 (identifier: A2APV2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     554-588: Missing.
     1056-1067: ALKKNNITKFPN → VLETNPTDEPMR
     1068-1086: Missing.

Note: No experimental confirmation available.
Show »
Length:1,032
Mass (Da):117,710
Checksum:i0FF576DB4E3D08D8
GO
Isoform 3 (identifier: A2APV2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1056-1086: ALKKNNITKFPNVHSRVRISSSTPVVEDTQS → DLRNQPYRRADAVRRSVRRRFDDQNLRSVNGAEITM

Note: No experimental confirmation available.
Show »
Length:1,091
Mass (Da):123,980
Checksum:i628270CEE84078F1
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8VPR2F8VPR2_MOUSE
Formin-like protein 2
Fmnl2
1,083Annotation score:
A2AQW2A2AQW2_MOUSE
Formin-like protein 2
Fmnl2
1,085Annotation score:
E9PXE6E9PXE6_MOUSE
Formin-like protein 2
Fmnl2
1,034Annotation score:

Sequence cautioni

The sequence AAP87551 differs from that shown. Reason: Erroneous initiation.Curated
The sequence CAM19613 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti557 – 591Missing in AAP87551 (Ref. 2) CuratedAdd BLAST35

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_025888554 – 588Missing in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_0258891056 – 1086ALKKN…EDTQS → DLRNQPYRRADAVRRSVRRR FDDQNLRSVNGAEITM in isoform 3. CuratedAdd BLAST31
Alternative sequenceiVSP_0258901056 – 1067ALKKN…TKFPN → VLETNPTDEPMR in isoform 2. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_0258911068 – 1086Missing in isoform 2. 1 PublicationAdd BLAST19

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL844859, AL844510, AL845170 Genomic DNA Translation: CAM19034.1
AL845170, AL844510, AL844859 Genomic DNA Translation: CAM19616.1
AL844510, AL844859, AL845170 Genomic DNA Translation: CAM25963.1
AL845170 Genomic DNA Translation: CAM19613.1 Sequence problems.
AF513716 mRNA Translation: AAP87551.1 Different initiation.
BC048004 mRNA Translation: AAH48004.1
AK173293 mRNA Translation: BAD32571.1
RefSeqiNP_765997.2, NM_172409.2
XP_006498396.1, XM_006498333.3 [A2APV2-3]
UniGeneiMm.394427

Genome annotation databases

EnsembliENSMUST00000090952; ENSMUSP00000088472; ENSMUSG00000036053 [A2APV2-3]
ENSMUST00000127122; ENSMUSP00000118658; ENSMUSG00000036053 [A2APV2-1]
GeneIDi71409
KEGGimmu:71409

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL844859, AL844510, AL845170 Genomic DNA Translation: CAM19034.1
AL845170, AL844510, AL844859 Genomic DNA Translation: CAM19616.1
AL844510, AL844859, AL845170 Genomic DNA Translation: CAM25963.1
AL845170 Genomic DNA Translation: CAM19613.1 Sequence problems.
AF513716 mRNA Translation: AAP87551.1 Different initiation.
BC048004 mRNA Translation: AAH48004.1
AK173293 mRNA Translation: BAD32571.1
RefSeqiNP_765997.2, NM_172409.2
XP_006498396.1, XM_006498333.3 [A2APV2-3]
UniGeneiMm.394427

3D structure databases

ProteinModelPortaliA2APV2
SMRiA2APV2
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi214689, 1 interactor
IntActiA2APV2, 1 interactor
STRINGi10090.ENSMUSP00000047260

PTM databases

iPTMnetiA2APV2
PhosphoSitePlusiA2APV2
SwissPalmiA2APV2

Proteomic databases

MaxQBiA2APV2
PaxDbiA2APV2
PeptideAtlasiA2APV2
PRIDEiA2APV2

Protocols and materials databases

DNASUi71409
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000090952; ENSMUSP00000088472; ENSMUSG00000036053 [A2APV2-3]
ENSMUST00000127122; ENSMUSP00000118658; ENSMUSG00000036053 [A2APV2-1]
GeneIDi71409
KEGGimmu:71409

Organism-specific databases

CTDi114793
MGIiMGI:1918659 Fmnl2
RougeiSearch...

Phylogenomic databases

eggNOGiKOG1923 Eukaryota
ENOG410Y3DT LUCA
GeneTreeiENSGT00760000118986
HOGENOMiHOG000231209
HOVERGENiHBG053118
InParanoidiA2APV2
OMAiMMPGFSP
OrthoDBiEOG091G01GP
PhylomeDBiA2APV2
TreeFamiTF325155

Enzyme and pathway databases

ReactomeiR-MMU-5663220 RHO GTPases Activate Formins

Miscellaneous databases

ChiTaRSiFmnl2 mouse
PROiPR:A2APV2
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000036053 Expressed in 236 organ(s), highest expression level in blastocyst
CleanExiMM_FMNL2
ExpressionAtlasiA2APV2 baseline and differential
GenevisibleiA2APV2 MM

Family and domain databases

InterProiView protein in InterPro
IPR016024 ARM-type_fold
IPR015425 FH2_Formin
IPR010472 FH3_dom
IPR027656 FMNL2
IPR014768 GBD/FH3_dom
IPR010473 GTPase-bd
PANTHERiPTHR23213:SF180 PTHR23213:SF180, 1 hit
PfamiView protein in Pfam
PF06367 Drf_FH3, 1 hit
PF06371 Drf_GBD, 2 hits
PF02181 FH2, 1 hit
SMARTiView protein in SMART
SM01139 Drf_FH3, 1 hit
SM01140 Drf_GBD, 1 hit
SM00498 FH2, 1 hit
SUPFAMiSSF48371 SSF48371, 2 hits
PROSITEiView protein in PROSITE
PS51444 FH2, 1 hit
PS51232 GBD_FH3, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiFMNL2_MOUSE
AccessioniPrimary (citable) accession number: A2APV2
Secondary accession number(s): A2AQW1
, Q69Z73, Q7TPA8, Q80VH6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: May 29, 2007
Last modified: September 12, 2018
This is version 98 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again