Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 92 (29 Sep 2021)
Sequence version 1 (05 Feb 2008)
Previous versions | rss
Add a publicationFeedback
Protein

Centlein

Gene

Cntln

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Required for centrosome cohesion and recruitment of CEP68 to centrosomes.

By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Centlein
Alternative name(s):
Centrosomal protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CntlnBy similarity
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2443104, Cntln

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSMUSG00000038070

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003289762 – 1397CentleinAdd BLAST1396

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineCombined sources1
Modified residuei5PhosphoserineCombined sources1
Modified residuei9PhosphoserineCombined sources1
Modified residuei22PhosphoserineBy similarity1
Modified residuei1219PhosphoserineCombined sources1
Modified residuei1334PhosphothreonineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated directly or indirectly by NEK2.By similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
A2AM05

MaxQB - The MaxQuant DataBase

More...
MaxQBi
A2AM05

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
A2AM05

PRoteomics IDEntifications database

More...
PRIDEi
A2AM05

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
285520 [A2AM05-1]
285521 [A2AM05-2]
285522 [A2AM05-3]
285523 [A2AM05-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
A2AM05

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
A2AM05

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000038070, Expressed in ear and 246 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
A2AM05, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with CEP250 and CEP68.

Interacts with NEK2; the interaction leads to phosphorylation of CNTLN.

By similarity

GO - Molecular functioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000099883

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
A2AM05, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
A2AM05

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 43DisorderedSequence analysisAdd BLAST43
Regioni56 – 76DisorderedSequence analysisAdd BLAST21
Regioni422 – 449DisorderedSequence analysisAdd BLAST28
Regioni485 – 521DisorderedSequence analysisAdd BLAST37

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili95 – 126Sequence analysisAdd BLAST32
Coiled coili405 – 481Sequence analysisAdd BLAST77
Coiled coili674 – 778Sequence analysisAdd BLAST105
Coiled coili973 – 1114Sequence analysisAdd BLAST142
Coiled coili1152 – 1299Sequence analysisAdd BLAST148

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi1 – 17Pro residuesSequence analysisAdd BLAST17
Compositional biasi430 – 449Polar residuesSequence analysisAdd BLAST20
Compositional biasi485 – 506Basic and acidic residuesSequence analysisAdd BLAST22

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502QRVC, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00440000034932

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_006488_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
A2AM05

Identification of Orthologs from Complete Genome Data

More...
OMAi
MSNMFEN

Database of Orthologous Groups

More...
OrthoDBi
846281at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
A2AM05

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR038810, CNTLN

The PANTHER Classification System

More...
PANTHERi
PTHR18957, PTHR18957, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 13 Publications (identifier: A2AM05-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAARSPSSSP PPPPVRRSSR RSLRVGRGAE VHAVRSEASG LAGAAREVVA
60 70 80 90 100
DKSDLLWRGE EGSGGRRGSG RAGAAVAPVA SAPAGSWWPE GLSSEEAKAT
110 120 130 140 150
RSQLLEEELS SLKEELALCQ ADKEFVWSLW RRLQATNPDL TQTVSLVVER
160 170 180 190 200
EKQKSEAKDR KVLEILQVKD SKIQELEQTE SVLKQELHDL VKLKTLVDEE
210 220 230 240 250
NAFLRKELCD LQKKFKDKSQ EVKDAKECVQ SKEEQNRLVI KNLEEENERL
260 270 280 290 300
RTRCTDLLND LEKLRNQEAH WRKEKHSVDT RVKVLEENLI EAKKEIESAQ
310 320 330 340 350
TKYNVVSQQL NNKQAELLQK DMDITLIRKE LQELQNVYKQ NSAHTAQQAD
360 370 380 390 400
LIQQLQALNM DTQKVLRNQE DVHTAESMSY QKLYNELHMC FETTKSNEVM
410 420 430 440 450
LRQSVVNLQG QLFQKEQENV KLKEKLEESQ GTAPSLSPHD SDSSHSGKAP
460 470 480 490 500
LSTLETLMIS QKSEIEYLQK KLKVANEKLM ANRSCDQDFS EKGTEGKHKE
510 520 530 540 550
PPVKRSRSLS PKSSFMGSEE LRKLKKAERK IENLEKTLQL KSQENDELRD
560 570 580 590 600
AHEKRKERLQ MLHTNYRAVK EQLKQWEEDS GMAESRQMKR AEPHQLRQED
610 620 630 640 650
SDAVWNELAY FKRENQELMV QKMTLQDELD ELKMHMSIDK TTIQELNRCM
660 670 680 690 700
AEKREEQLFR QHEDAEVKKS TPEKNEKAIS EETLQKVIEL ENRLKSFEKN
710 720 730 740 750
SRKLKEESKR LKKENDFLKS HLKHYQEDSE AREKELEQLL RVSKDVEHDK
760 770 780 790 800
SELQTKITAL ETEVTTLRRQ VTEAKALRGK DEEVVCPEER AHRPTDKAKS
810 820 830 840 850
EMATTDVRAR RCDCKTATTK VKFKAAKRKC SVGRHHTVLN HSIKVMSHVE
860 870 880 890 900
NLSKDGWEDV SEGSSDSETQ TFQNLGTIIV ETSQNISPIE DGRNQKEIDQ
910 920 930 940 950
TEGSCAQQRA MQTYSCEDIK APQSISHNKN TKKMTFQKKS GSLQKSLHSA
960 970 980 990 1000
LPARVNREKC KNLPAQKSSS STISLRERIV SLQQQNSLLQ NARRAAEASA
1010 1020 1030 1040 1050
KEYKEANEKL LHQQQVSDHR FQTSRQTIKK LTLDLAELRK EKEDLLKKVE
1060 1070 1080 1090 1100
SSSDIMSLAE EVSRIMAPQI KVTTLGPSRS MDLEMKQLQC KLKNATNELT
1110 1120 1130 1140 1150
KQSSNVKSLR MELLAKDDHI KEMHERTSRM ERDITMKRHL IEDLKFRQKV
1160 1170 1180 1190 1200
NSESNESFNE MLETLEKKVK SLTEECSNKK VSVDSLKQRL NVAVKEKSQY
1210 1220 1230 1240 1250
EQMYQKTKEE LEKKDLKMSV LISKLNDTET AMAQIETAAS EQLQGLALQS
1260 1270 1280 1290 1300
EQVLEGAQKK LLSANEKIEE FTVFVKALVN ELQSDVHGTR HQIRELKKMQ
1310 1320 1330 1340 1350
KSRHACKTST HKAQTLAASI LNISRSDLEE ILDTEDELEI EKTKIDIEND
1360 1370 1380 1390
KEWMLYIQKL LEGQLPFASY LLEAVLEKIK ENKKLTEGYF TVMKDTK
Length:1,397
Mass (Da):160,747
Last modified:February 5, 2008 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i644CC6C2843C3F27
GO
Isoform 22 Publications (identifier: A2AM05-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     285-318: LEENLIEAKKEIESAQTKYNVVSQQLNNKQAELL → QGGPVSMSCPGPSFLQQPNIRFSLNNKLSIQIHQ
     319-1397: Missing.

Show »
Length:318
Mass (Da):35,725
Checksum:i2B665C5E02E3AC08
GO
Isoform 31 Publication (identifier: A2AM05-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1135: Missing.

Show »
Length:262
Mass (Da):30,301
Checksum:i59DD626F26C5FAD5
GO
Isoform 4 (identifier: A2AM05-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     865-865: Missing.

Show »
Length:1,396
Mass (Da):160,660
Checksum:i421711533D9FB96E
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH24869 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence BAC26307 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti484S → F in BAC35037 (PubMed:16141072).Curated1
Sequence conflicti701S → P in BAC35037 (PubMed:16141072).Curated1
Sequence conflicti1021F → L in AAL89759 (Ref. 4) Curated1
Sequence conflicti1056M → T in AAL89759 (Ref. 4) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0527851 – 1135Missing in isoform 3. 1 PublicationAdd BLAST1135
Alternative sequenceiVSP_052786285 – 318LEENL…QAELL → QGGPVSMSCPGPSFLQQPNI RFSLNNKLSIQIHQ in isoform 2. 2 PublicationsAdd BLAST34
Alternative sequenceiVSP_052787319 – 1397Missing in isoform 2. 2 PublicationsAdd BLAST1079
Alternative sequenceiVSP_032866865Missing in isoform 4. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK029118 mRNA Translation: BAC26307.1 Different initiation.
AK031604 mRNA Translation: BAC27472.1
AK040554 mRNA Translation: BAC30624.1
AK052558 mRNA Translation: BAC35037.2
AK165111 mRNA Translation: BAE38040.1
AL805906, AL806524, BX470174 Genomic DNA Translation: CAM13729.1
AL805906, BX470174 Genomic DNA Translation: CAM13730.1
AL806524 Genomic DNA Translation: CAM15708.1
AL806524, AL805906, BX470174 Genomic DNA Translation: CAM15709.1
BX470174, AL805906, AL806524 Genomic DNA Translation: CAM21915.1
BX470174, AL805906 Genomic DNA Translation: CAM21916.1
BC024869 mRNA Translation: AAH24869.1 Sequence problems.
BC027370 mRNA Translation: AAH27370.1
BC089374 mRNA Translation: AAH89374.1
BC125622 mRNA Translation: AAI25623.1
BC125624 mRNA Translation: AAI25625.1
AF483477 mRNA Translation: AAL89759.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS18302.1 [A2AM05-2]
CCDS51216.1 [A2AM05-4]

NCBI Reference Sequences

More...
RefSeqi
NP_780484.2, NM_175275.4 [A2AM05-4]
NP_796359.1, NM_177385.4 [A2AM05-2]
XP_006538089.1, XM_006538026.3 [A2AM05-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000047023; ENSMUSP00000044138; ENSMUSG00000038070 [A2AM05-1]
ENSMUST00000102819; ENSMUSP00000099883; ENSMUSG00000038070 [A2AM05-2]
ENSMUST00000107190; ENSMUSP00000102808; ENSMUSG00000038070 [A2AM05-3]
ENSMUST00000169371; ENSMUSP00000130491; ENSMUSG00000038070 [A2AM05-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
338349

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:338349

UCSC genome browser

More...
UCSCi
uc008tlk.2, mouse [A2AM05-2]
uc008tll.2, mouse [A2AM05-4]
uc008tln.2, mouse [A2AM05-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK029118 mRNA Translation: BAC26307.1 Different initiation.
AK031604 mRNA Translation: BAC27472.1
AK040554 mRNA Translation: BAC30624.1
AK052558 mRNA Translation: BAC35037.2
AK165111 mRNA Translation: BAE38040.1
AL805906, AL806524, BX470174 Genomic DNA Translation: CAM13729.1
AL805906, BX470174 Genomic DNA Translation: CAM13730.1
AL806524 Genomic DNA Translation: CAM15708.1
AL806524, AL805906, BX470174 Genomic DNA Translation: CAM15709.1
BX470174, AL805906, AL806524 Genomic DNA Translation: CAM21915.1
BX470174, AL805906 Genomic DNA Translation: CAM21916.1
BC024869 mRNA Translation: AAH24869.1 Sequence problems.
BC027370 mRNA Translation: AAH27370.1
BC089374 mRNA Translation: AAH89374.1
BC125622 mRNA Translation: AAI25623.1
BC125624 mRNA Translation: AAI25625.1
AF483477 mRNA Translation: AAL89759.1
CCDSiCCDS18302.1 [A2AM05-2]
CCDS51216.1 [A2AM05-4]
RefSeqiNP_780484.2, NM_175275.4 [A2AM05-4]
NP_796359.1, NM_177385.4 [A2AM05-2]
XP_006538089.1, XM_006538026.3 [A2AM05-1]

3D structure databases

SMRiA2AM05
ModBaseiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000099883

PTM databases

iPTMnetiA2AM05
PhosphoSitePlusiA2AM05

Proteomic databases

jPOSTiA2AM05
MaxQBiA2AM05
PaxDbiA2AM05
PRIDEiA2AM05
ProteomicsDBi285520 [A2AM05-1]
285521 [A2AM05-2]
285522 [A2AM05-3]
285523 [A2AM05-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
24606, 87 antibodies

Genome annotation databases

EnsembliENSMUST00000047023; ENSMUSP00000044138; ENSMUSG00000038070 [A2AM05-1]
ENSMUST00000102819; ENSMUSP00000099883; ENSMUSG00000038070 [A2AM05-2]
ENSMUST00000107190; ENSMUSP00000102808; ENSMUSG00000038070 [A2AM05-3]
ENSMUST00000169371; ENSMUSP00000130491; ENSMUSG00000038070 [A2AM05-4]
GeneIDi338349
KEGGimmu:338349
UCSCiuc008tlk.2, mouse [A2AM05-2]
uc008tll.2, mouse [A2AM05-4]
uc008tln.2, mouse [A2AM05-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
54875
MGIiMGI:2443104, Cntln
VEuPathDBiHostDB:ENSMUSG00000038070

Phylogenomic databases

eggNOGiENOG502QRVC, Eukaryota
GeneTreeiENSGT00440000034932
HOGENOMiCLU_006488_1_0_1
InParanoidiA2AM05
OMAiMSNMFEN
OrthoDBi846281at2759
PhylomeDBiA2AM05

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
338349, 2 hits in 63 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Cntln, mouse

Protein Ontology

More...
PROi
PR:A2AM05
RNActiA2AM05, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000038070, Expressed in ear and 246 other tissues
GenevisibleiA2AM05, MM

Family and domain databases

InterProiView protein in InterPro
IPR038810, CNTLN
PANTHERiPTHR18957, PTHR18957, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCNTLN_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: A2AM05
Secondary accession number(s): A0PJC6
, Q3TNP8, Q5EBN8, Q8C748, Q8C9U3, Q8CD25, Q8CE32, Q8R2F0, Q8R2P3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 8, 2008
Last sequence update: February 5, 2008
Last modified: September 29, 2021
This is version 92 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again