Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Centlein

Gene

Cntln

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Required for centrosome cohesion and recruitment of CEP68 to centrosomes.By similarity

GO - Molecular functioni

GO - Biological processi

Names & Taxonomyi

Protein namesi
Recommended name:
Centlein
Alternative name(s):
Centrosomal protein
Gene namesi
Name:CntlnBy similarity
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 4

Organism-specific databases

MGIiMGI:2443104 Cntln

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00003289762 – 1397CentleinAdd BLAST1396

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1
Modified residuei5PhosphoserineCombined sources1
Modified residuei9PhosphoserineCombined sources1
Modified residuei22PhosphoserineBy similarity1
Modified residuei1219PhosphoserineCombined sources1
Modified residuei1334PhosphothreonineCombined sources1

Post-translational modificationi

Phosphorylated directly or indirectly by NEK2.By similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiA2AM05
PaxDbiA2AM05
PRIDEiA2AM05

PTM databases

iPTMnetiA2AM05
PhosphoSitePlusiA2AM05

Expressioni

Gene expression databases

BgeeiENSMUSG00000038070 Expressed in 214 organ(s), highest expression level in ear
GenevisibleiA2AM05 MM

Interactioni

Subunit structurei

Interacts with CEP250 and CEP68. Interacts with NEK2; the interaction leads to phosphorylation of CNTLN.By similarity

GO - Molecular functioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000130491

Structurei

3D structure databases

SMRiA2AM05
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili95 – 126Sequence analysisAdd BLAST32
Coiled coili405 – 481Sequence analysisAdd BLAST77
Coiled coili674 – 778Sequence analysisAdd BLAST105
Coiled coili973 – 1114Sequence analysisAdd BLAST142
Coiled coili1152 – 1299Sequence analysisAdd BLAST148

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IHKZ Eukaryota
ENOG410XRNE LUCA
GeneTreeiENSGT00440000034932
HOVERGENiHBG107737
InParanoidiA2AM05
KOiK16467
OMAiYDCKTTT
OrthoDBiEOG091G0JYN
PhylomeDBiA2AM05

Family and domain databases

InterProiView protein in InterPro
IPR038810 CNTLN
PANTHERiPTHR18957 PTHR18957, 1 hit

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 13 Publications (identifier: A2AM05-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAARSPSSSP PPPPVRRSSR RSLRVGRGAE VHAVRSEASG LAGAAREVVA
60 70 80 90 100
DKSDLLWRGE EGSGGRRGSG RAGAAVAPVA SAPAGSWWPE GLSSEEAKAT
110 120 130 140 150
RSQLLEEELS SLKEELALCQ ADKEFVWSLW RRLQATNPDL TQTVSLVVER
160 170 180 190 200
EKQKSEAKDR KVLEILQVKD SKIQELEQTE SVLKQELHDL VKLKTLVDEE
210 220 230 240 250
NAFLRKELCD LQKKFKDKSQ EVKDAKECVQ SKEEQNRLVI KNLEEENERL
260 270 280 290 300
RTRCTDLLND LEKLRNQEAH WRKEKHSVDT RVKVLEENLI EAKKEIESAQ
310 320 330 340 350
TKYNVVSQQL NNKQAELLQK DMDITLIRKE LQELQNVYKQ NSAHTAQQAD
360 370 380 390 400
LIQQLQALNM DTQKVLRNQE DVHTAESMSY QKLYNELHMC FETTKSNEVM
410 420 430 440 450
LRQSVVNLQG QLFQKEQENV KLKEKLEESQ GTAPSLSPHD SDSSHSGKAP
460 470 480 490 500
LSTLETLMIS QKSEIEYLQK KLKVANEKLM ANRSCDQDFS EKGTEGKHKE
510 520 530 540 550
PPVKRSRSLS PKSSFMGSEE LRKLKKAERK IENLEKTLQL KSQENDELRD
560 570 580 590 600
AHEKRKERLQ MLHTNYRAVK EQLKQWEEDS GMAESRQMKR AEPHQLRQED
610 620 630 640 650
SDAVWNELAY FKRENQELMV QKMTLQDELD ELKMHMSIDK TTIQELNRCM
660 670 680 690 700
AEKREEQLFR QHEDAEVKKS TPEKNEKAIS EETLQKVIEL ENRLKSFEKN
710 720 730 740 750
SRKLKEESKR LKKENDFLKS HLKHYQEDSE AREKELEQLL RVSKDVEHDK
760 770 780 790 800
SELQTKITAL ETEVTTLRRQ VTEAKALRGK DEEVVCPEER AHRPTDKAKS
810 820 830 840 850
EMATTDVRAR RCDCKTATTK VKFKAAKRKC SVGRHHTVLN HSIKVMSHVE
860 870 880 890 900
NLSKDGWEDV SEGSSDSETQ TFQNLGTIIV ETSQNISPIE DGRNQKEIDQ
910 920 930 940 950
TEGSCAQQRA MQTYSCEDIK APQSISHNKN TKKMTFQKKS GSLQKSLHSA
960 970 980 990 1000
LPARVNREKC KNLPAQKSSS STISLRERIV SLQQQNSLLQ NARRAAEASA
1010 1020 1030 1040 1050
KEYKEANEKL LHQQQVSDHR FQTSRQTIKK LTLDLAELRK EKEDLLKKVE
1060 1070 1080 1090 1100
SSSDIMSLAE EVSRIMAPQI KVTTLGPSRS MDLEMKQLQC KLKNATNELT
1110 1120 1130 1140 1150
KQSSNVKSLR MELLAKDDHI KEMHERTSRM ERDITMKRHL IEDLKFRQKV
1160 1170 1180 1190 1200
NSESNESFNE MLETLEKKVK SLTEECSNKK VSVDSLKQRL NVAVKEKSQY
1210 1220 1230 1240 1250
EQMYQKTKEE LEKKDLKMSV LISKLNDTET AMAQIETAAS EQLQGLALQS
1260 1270 1280 1290 1300
EQVLEGAQKK LLSANEKIEE FTVFVKALVN ELQSDVHGTR HQIRELKKMQ
1310 1320 1330 1340 1350
KSRHACKTST HKAQTLAASI LNISRSDLEE ILDTEDELEI EKTKIDIEND
1360 1370 1380 1390
KEWMLYIQKL LEGQLPFASY LLEAVLEKIK ENKKLTEGYF TVMKDTK
Length:1,397
Mass (Da):160,747
Last modified:February 5, 2008 - v1
Checksum:i644CC6C2843C3F27
GO
Isoform 22 Publications (identifier: A2AM05-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     285-318: LEENLIEAKKEIESAQTKYNVVSQQLNNKQAELL → QGGPVSMSCPGPSFLQQPNIRFSLNNKLSIQIHQ
     319-1397: Missing.

Show »
Length:318
Mass (Da):35,725
Checksum:i2B665C5E02E3AC08
GO
Isoform 31 Publication (identifier: A2AM05-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1135: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:262
Mass (Da):30,301
Checksum:i59DD626F26C5FAD5
GO
Isoform 4 (identifier: A2AM05-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     865-865: Missing.

Note: No experimental confirmation available.
Show »
Length:1,396
Mass (Da):160,660
Checksum:i421711533D9FB96E
GO

Sequence cautioni

The sequence AAH24869 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence BAC26307 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti484S → F in BAC35037 (PubMed:16141072).Curated1
Sequence conflicti701S → P in BAC35037 (PubMed:16141072).Curated1
Sequence conflicti1021F → L in AAL89759 (Ref. 4) Curated1
Sequence conflicti1056M → T in AAL89759 (Ref. 4) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0527851 – 1135Missing in isoform 3. 1 PublicationAdd BLAST1135
Alternative sequenceiVSP_052786285 – 318LEENL…QAELL → QGGPVSMSCPGPSFLQQPNI RFSLNNKLSIQIHQ in isoform 2. 2 PublicationsAdd BLAST34
Alternative sequenceiVSP_052787319 – 1397Missing in isoform 2. 2 PublicationsAdd BLAST1079
Alternative sequenceiVSP_032866865Missing in isoform 4. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK029118 mRNA Translation: BAC26307.1 Different initiation.
AK031604 mRNA Translation: BAC27472.1
AK040554 mRNA Translation: BAC30624.1
AK052558 mRNA Translation: BAC35037.2
AK165111 mRNA Translation: BAE38040.1
AL805906, AL806524, BX470174 Genomic DNA Translation: CAM13729.1
AL805906, BX470174 Genomic DNA Translation: CAM13730.1
AL806524 Genomic DNA Translation: CAM15708.1
AL806524, AL805906, BX470174 Genomic DNA Translation: CAM15709.1
BX470174, AL805906, AL806524 Genomic DNA Translation: CAM21915.1
BX470174, AL805906 Genomic DNA Translation: CAM21916.1
BC024869 mRNA Translation: AAH24869.1 Sequence problems.
BC027370 mRNA Translation: AAH27370.1
BC089374 mRNA Translation: AAH89374.1
BC125622 mRNA Translation: AAI25623.1
BC125624 mRNA Translation: AAI25625.1
AF483477 mRNA Translation: AAL89759.1
CCDSiCCDS18302.1 [A2AM05-2]
CCDS51216.1 [A2AM05-4]
RefSeqiNP_780484.2, NM_175275.4 [A2AM05-4]
NP_796359.1, NM_177385.4 [A2AM05-2]
XP_006538089.1, XM_006538026.3 [A2AM05-1]
UniGeneiMm.440562

Genome annotation databases

EnsembliENSMUST00000047023; ENSMUSP00000044138; ENSMUSG00000038070 [A2AM05-1]
ENSMUST00000102819; ENSMUSP00000099883; ENSMUSG00000038070 [A2AM05-2]
ENSMUST00000107190; ENSMUSP00000102808; ENSMUSG00000038070 [A2AM05-3]
ENSMUST00000169371; ENSMUSP00000130491; ENSMUSG00000038070 [A2AM05-4]
GeneIDi338349
KEGGimmu:338349
UCSCiuc008tlk.2 mouse [A2AM05-2]
uc008tll.2 mouse [A2AM05-4]
uc008tln.2 mouse [A2AM05-3]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK029118 mRNA Translation: BAC26307.1 Different initiation.
AK031604 mRNA Translation: BAC27472.1
AK040554 mRNA Translation: BAC30624.1
AK052558 mRNA Translation: BAC35037.2
AK165111 mRNA Translation: BAE38040.1
AL805906, AL806524, BX470174 Genomic DNA Translation: CAM13729.1
AL805906, BX470174 Genomic DNA Translation: CAM13730.1
AL806524 Genomic DNA Translation: CAM15708.1
AL806524, AL805906, BX470174 Genomic DNA Translation: CAM15709.1
BX470174, AL805906, AL806524 Genomic DNA Translation: CAM21915.1
BX470174, AL805906 Genomic DNA Translation: CAM21916.1
BC024869 mRNA Translation: AAH24869.1 Sequence problems.
BC027370 mRNA Translation: AAH27370.1
BC089374 mRNA Translation: AAH89374.1
BC125622 mRNA Translation: AAI25623.1
BC125624 mRNA Translation: AAI25625.1
AF483477 mRNA Translation: AAL89759.1
CCDSiCCDS18302.1 [A2AM05-2]
CCDS51216.1 [A2AM05-4]
RefSeqiNP_780484.2, NM_175275.4 [A2AM05-4]
NP_796359.1, NM_177385.4 [A2AM05-2]
XP_006538089.1, XM_006538026.3 [A2AM05-1]
UniGeneiMm.440562

3D structure databases

SMRiA2AM05
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000130491

PTM databases

iPTMnetiA2AM05
PhosphoSitePlusiA2AM05

Proteomic databases

MaxQBiA2AM05
PaxDbiA2AM05
PRIDEiA2AM05

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000047023; ENSMUSP00000044138; ENSMUSG00000038070 [A2AM05-1]
ENSMUST00000102819; ENSMUSP00000099883; ENSMUSG00000038070 [A2AM05-2]
ENSMUST00000107190; ENSMUSP00000102808; ENSMUSG00000038070 [A2AM05-3]
ENSMUST00000169371; ENSMUSP00000130491; ENSMUSG00000038070 [A2AM05-4]
GeneIDi338349
KEGGimmu:338349
UCSCiuc008tlk.2 mouse [A2AM05-2]
uc008tll.2 mouse [A2AM05-4]
uc008tln.2 mouse [A2AM05-3]

Organism-specific databases

CTDi54875
MGIiMGI:2443104 Cntln

Phylogenomic databases

eggNOGiENOG410IHKZ Eukaryota
ENOG410XRNE LUCA
GeneTreeiENSGT00440000034932
HOVERGENiHBG107737
InParanoidiA2AM05
KOiK16467
OMAiYDCKTTT
OrthoDBiEOG091G0JYN
PhylomeDBiA2AM05

Miscellaneous databases

PROiPR:A2AM05
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000038070 Expressed in 214 organ(s), highest expression level in ear
GenevisibleiA2AM05 MM

Family and domain databases

InterProiView protein in InterPro
IPR038810 CNTLN
PANTHERiPTHR18957 PTHR18957, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiCNTLN_MOUSE
AccessioniPrimary (citable) accession number: A2AM05
Secondary accession number(s): A0PJC6
, Q3TNP8, Q5EBN8, Q8C748, Q8C9U3, Q8CD25, Q8CE32, Q8R2F0, Q8R2P3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 8, 2008
Last sequence update: February 5, 2008
Last modified: November 7, 2018
This is version 78 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again